SecReT4
Protein ID: 118577374
T4SS name [ID]Tra_F [802]
Gene symbol-
Locus tagPpro_3772
StrainPelobacter propionicus DSM 2379
Repliconplasmid pPRO1 [GenBank: NC_008607] [Browse all T4SS(s) in this replicon]
Location [Strand]146125..147114 [-]
ProductTraU family protein
Component typeTraU_F
UniProt IDA0R7Q3
KEGG IDppd:Ppro_3772
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 1.5e-52, Aligned region: 21..322
Protein Sequence: 329 a.a.     [Download]
>gi|118577374|ref|YP_899614.1| TraU family protein [Pelobacter propionicus DSM 2379]
MTRIVVFAILLLCAAANSFAGVINPVTDVCWRCMFPMTTGGVSWGDAGEPAAGNVTTPVCTCVGTSGVRI
GVTASFNEHAWLIESVKTPYYFPALGTKLNNTSPGYNAGDTRGATGQHVRESFHHVHQYTFPVYGIVGLF
LDMPCLEQDSFDLAYMTEVDDMWSEDLLAMLINPEALAFGNPVTQMSCISDAVAAGAGYPIDSLFWCFGS
WGSSYPLTGTTVIDDPVTAAAATASRMIFKLGREGALWDTGIDECSSRGVLTPFMVKSHYKFQIARPVVG
NQCVPIGRTALLWGPGKNPIVGGAGKVDEFLWVATRRRVCCVAYNLTDQ
 
Nucleotide Sequence: 990 bp     [Download]
>gi|118577231|ref|NC_008607.1|:c147114-146125 Pelobacter propionicus DSM 2379 plasmid pPRO1, complete sequence
ATGACCAGAATAGTGGTTTTTGCGATCTTGTTGCTTTGTGCCGCGGCAAATTCGTTTGCCGGAGTTATTA
ATCCAGTAACGGATGTTTGTTGGCGCTGCATGTTTCCTATGACAACAGGTGGGGTTTCCTGGGGAGATGC
TGGGGAGCCGGCGGCGGGAAATGTGACAACACCAGTCTGTACTTGCGTCGGGACCAGCGGCGTAAGGATA
GGGGTAACTGCCTCATTCAATGAGCATGCTTGGCTGATTGAATCGGTGAAGACTCCCTATTATTTTCCTG
CGTTGGGAACAAAATTGAACAATACGTCTCCAGGCTATAACGCAGGGGATACACGCGGAGCAACAGGTCA
ACATGTTCGTGAGTCGTTTCATCATGTGCATCAGTACACGTTTCCCGTGTATGGAATTGTGGGGCTTTTC
CTTGATATGCCATGTTTGGAACAGGATTCCTTTGACCTTGCCTACATGACAGAAGTTGATGATATGTGGT
CTGAAGATCTTCTGGCCATGCTGATCAATCCAGAAGCTCTTGCGTTCGGAAACCCGGTAACCCAGATGTC
ATGCATATCTGATGCTGTTGCGGCGGGTGCGGGCTATCCCATTGACTCGCTGTTTTGGTGCTTCGGATCG
TGGGGCTCGTCATATCCACTGACCGGTACAACTGTAATTGACGATCCTGTGACGGCTGCTGCTGCTACTG
CGTCCAGGATGATTTTCAAGCTCGGGAGGGAAGGCGCCTTGTGGGACACGGGAATTGACGAGTGTTCGAG
TAGAGGTGTTTTGACTCCGTTCATGGTTAAGTCTCACTATAAATTTCAGATTGCTCGGCCGGTAGTCGGC
AATCAGTGTGTACCGATAGGAAGGACTGCACTTCTTTGGGGCCCTGGCAAAAACCCGATTGTTGGCGGTG
CAGGAAAAGTTGATGAGTTTCTGTGGGTAGCAACAAGGAGGCGGGTGTGCTGCGTCGCGTACAACTTAAC
AGATCAATAA