SecReT4
Protein ID: 118577373
T4SS name [ID]Tra_F [802]
Gene symbol-
Locus tagPpro_3771
StrainPelobacter propionicus DSM 2379
Repliconplasmid pPRO1 [GenBank: NC_008607] [Browse all T4SS(s) in this replicon]
Location [Strand]145175..146125 [-]
Producthypothetical protein
Component typeTrbC_F
UniProt IDA0R7Q2
KEGG IDppd:Ppro_3771
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 7.5e-31, Aligned region: 177..311
Protein Sequence: 316 a.a.     [Download]
>gi|118577373|ref|YP_899613.1| hypothetical protein Ppro_3771 [Pelobacter propionicus DSM 2379]
MVFALTLVPTLAGAAGFIETPDECYMVKTMDKPAKTIQLAAMGRCQGRPGRVFVDLDGEVTVLRDGAVWK
RQTVQPMSMPDLVGTMVKAKEMAKSMVLPKNAFEKEMQAKAAETIAVYRSPEYQAKLARETARIKREMFH
EQLEAIPADRGGAKQVKALAKQESPKRARLQDDERIYVFISSSMPMETIRNYAVSAGQYNDPKKVVLVMR
GFIGGMQKIGPTTSFVADVLKRSATCNLAAGEQCDMVNTNVLIDPILFRRYGIREVPATVYAKGVKVNLP
EQSEGNDDVVVGSFAVAYGDASLEYNLSKIAGSVSR
 
Nucleotide Sequence: 951 bp     [Download]
>gi|118577231|ref|NC_008607.1|:c146125-145175 Pelobacter propionicus DSM 2379 plasmid pPRO1, complete sequence
ATGGTTTTTGCTCTCACGCTTGTACCCACCTTGGCTGGTGCGGCAGGCTTTATTGAGACCCCTGATGAAT
GTTACATGGTCAAGACAATGGACAAGCCCGCAAAGACTATTCAGCTCGCTGCTATGGGTCGGTGTCAGGG
GAGGCCAGGCCGGGTTTTTGTGGACCTTGATGGAGAGGTCACGGTTTTACGGGATGGGGCAGTATGGAAG
AGACAAACTGTTCAGCCAATGTCTATGCCTGATCTAGTGGGAACTATGGTGAAGGCGAAGGAGATGGCAA
AGTCCATGGTTTTGCCCAAAAACGCTTTTGAGAAGGAAATGCAGGCGAAAGCAGCTGAGACGATAGCCGT
TTACAGGTCCCCTGAATACCAGGCAAAACTCGCCAGAGAAACGGCGAGGATAAAGAGGGAGATGTTCCAT
GAACAGTTGGAGGCGATCCCTGCCGACAGGGGGGGGGCGAAGCAAGTCAAGGCGCTCGCCAAACAGGAGT
CTCCAAAGCGGGCTCGCCTGCAGGATGATGAGCGCATCTACGTTTTTATTTCGTCTTCAATGCCCATGGA
AACGATTCGTAATTATGCGGTGTCGGCTGGCCAATACAATGACCCCAAAAAGGTTGTTTTAGTGATGAGG
GGGTTCATTGGTGGCATGCAGAAGATAGGGCCGACAACAAGTTTCGTTGCCGACGTGTTGAAGAGGTCTG
CAACGTGTAATCTGGCGGCCGGTGAGCAATGTGATATGGTGAATACCAATGTGCTGATCGATCCGATACT
TTTTCGGCGATATGGAATCCGGGAAGTGCCGGCCACTGTATATGCAAAAGGAGTAAAGGTTAATTTGCCT
GAGCAGAGCGAAGGTAATGATGATGTTGTGGTCGGATCCTTTGCGGTTGCGTATGGTGACGCCTCGCTTG
AATACAATTTGAGCAAGATTGCTGGATCTGTTTCCAGATAG