SecReT4
Protein ID: 330822145
T4SS name [ID]Tra_F [549]
Gene symbol-
Locus tagbgla_2p0530
StrainBurkholderia gladioli BSR3
Repliconplasmid bgla_2p [GenBank: NC_015377] [Browse all T4SS(s) in this replicon]
Location [Strand]61058..63223 [-]
ProductType IV secretory pathway VirD4 components-like protein
Component typeTraD_F
UniProt IDF2LS95
KEGG IDbgd:bgla_2p0530
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 7.1e-139, Aligned region: 171..556
TraG-D_C [PF12696], Evalue: 1.1e-18, Aligned region: 416..537
T4SS-DNA_transf [PF02534], Evalue: 2.3e-12, Aligned region: 373..558
AAA_10 [PF12846], Evalue: 9.3e-11, Aligned region: 412..494
TraD_N [PF12615], Evalue: 1.2e-06, Aligned region: 38..128
Protein Sequence: 721 a.a.     [Download]
>gi|330822145|ref|YP_004350973.1| Type IV secretory pathway VirD4 components-like protein [Burkholderia gladioli BSR3]
MSDPRAPNSLATFSRGTILWWQQAKLLTSAIVAVLVSAIVVGVLAGGAYLYLITSAQTRYLAIKHAEAEF
LTIVPMANPNVSFHFGEDVTTLPPDAALSFTEEAADEFFVYARNAALYAVLTTIGVFIFAVIFWMEYGRG
RLTDKQIRGARLVKAKELTKELEAQDDASPYRIAGVPMRKTAENLNLLIAGAQGTGKSQQFFALIDQVRA
RGRRAIVYDTSGEFTATYFREGKDIILNPFDARSPNWNVWREIQEDYHNDGIAEGMIPIPPNVPDPFFAM
AGRMVLKDTIRALGESGKRTNAALYRAIAHSNLEELHAILIKQAAATYVDPITERTGMSLKMTVQNQLDC
FRYLHDEGESFSIREWVQNDDPKDDSWLFISCNEEQKLAILPLISLWCDIAIRSLLTLEPTHSERLWYFY
DELPTLQKLEIMKLAATNIRKFGGCFVIGLQDFSQLFQIYGEHLARTIISGCQTKLLLRVTDGDAAKALA
NAIGQADLDEKEESVNLGIDERRDGMSVFARRNLRDLVLSSEILRLPDMQGYVVTPGPYPIARVKYRYVP
HAKIAKSYIPRKSFGLVLPPGDGAAAAPGTGAAPASALTAPATASAQQASTPPAAAAAQTKPTQPTQPIA
PVQAPASSESQGAPKPAPAGSALTPLPTPAEAATSSPSDGRSGSDGSNLIVLPSGAVVDGDTGEVQGKVS
PQDGQSDRGQSGSLGFDDLLR
 
Nucleotide Sequence: 2166 bp     [Download]
>gi|330822093|ref|NC_015377.1|:c63223-61058 Burkholderia gladioli BSR3 plasmid bgla_2p, complete sequence
GTGTCTGATCCGCGCGCTCCGAATAGCCTCGCGACATTTTCGCGCGGCACGATCTTGTGGTGGCAGCAGG
CCAAGCTTTTGACCAGCGCCATCGTCGCCGTGCTCGTTTCCGCTATCGTCGTGGGTGTCCTCGCGGGCGG
CGCCTACCTCTACCTGATCACTTCCGCGCAGACTCGCTATCTCGCCATCAAGCACGCCGAGGCCGAATTC
CTCACCATCGTGCCCATGGCGAATCCGAATGTCTCGTTCCATTTTGGTGAAGACGTCACCACTCTCCCAC
CGGACGCAGCGTTGTCTTTTACCGAGGAAGCCGCCGACGAGTTTTTCGTCTACGCCCGAAACGCTGCACT
CTATGCCGTGCTCACCACCATCGGCGTTTTCATCTTCGCTGTCATCTTCTGGATGGAGTACGGCCGCGGC
AGGCTCACCGACAAGCAGATTCGCGGCGCCCGGCTCGTCAAAGCCAAAGAGCTGACCAAGGAGCTGGAAG
CGCAGGACGACGCCAGCCCGTACCGCATCGCCGGCGTGCCTATGCGAAAGACCGCGGAGAACCTCAATTT
GCTCATCGCGGGCGCACAAGGCACGGGCAAATCCCAGCAGTTCTTTGCGTTGATCGACCAGGTCCGCGCT
CGGGGAAGACGCGCCATTGTGTACGACACCTCCGGCGAGTTCACCGCGACCTACTTTCGCGAGGGTAAGG
ACATCATCCTCAACCCGTTCGACGCGCGTAGTCCCAATTGGAACGTCTGGCGTGAGATCCAGGAGGACTA
CCATAACGACGGTATAGCGGAGGGCATGATCCCCATCCCGCCCAACGTCCCGGATCCCTTCTTTGCCATG
GCGGGGCGCATGGTCTTGAAGGACACCATCCGTGCCTTGGGCGAGTCCGGAAAGCGCACCAACGCGGCGC
TTTACAGGGCCATCGCCCACAGCAACCTGGAGGAACTGCATGCCATTTTGATCAAGCAGGCCGCCGCCAC
CTACGTGGACCCGATCACCGAGCGCACGGGTATGAGCCTCAAGATGACCGTGCAGAACCAGCTCGACTGC
TTCCGATATCTGCATGACGAAGGTGAGTCGTTTTCGATTCGCGAATGGGTACAAAACGACGATCCGAAAG
ACGATTCCTGGCTGTTTATCTCCTGTAACGAGGAACAAAAACTCGCGATCTTGCCGCTGATCAGTCTGTG
GTGCGATATCGCCATTCGGTCGCTTCTCACGCTTGAGCCTACCCATAGCGAGCGCCTGTGGTACTTCTAT
GACGAGTTGCCGACGCTGCAGAAGCTTGAAATCATGAAGCTCGCTGCTACGAATATTCGAAAATTTGGCG
GGTGCTTCGTCATCGGCCTCCAGGACTTCTCGCAGCTCTTCCAGATTTACGGCGAGCACCTGGCCAGGAC
CATCATCTCCGGGTGTCAGACCAAGCTCCTGTTGCGCGTCACCGACGGCGACGCCGCAAAGGCGCTGGCC
AACGCGATCGGTCAAGCCGATCTCGACGAAAAAGAGGAAAGCGTCAATCTCGGCATCGACGAGCGCCGCG
ACGGCATGAGCGTTTTCGCCCGACGCAACCTCCGTGACCTGGTGCTCTCTTCCGAAATTCTGCGCTTGCC
CGACATGCAAGGCTATGTGGTGACGCCTGGTCCTTATCCGATTGCCCGGGTCAAGTATCGCTACGTGCCG
CATGCAAAAATCGCCAAATCGTACATTCCTCGCAAATCGTTCGGTTTGGTGCTTCCCCCGGGGGACGGCG
CCGCCGCGGCCCCCGGGACGGGTGCCGCGCCCGCGTCTGCGTTGACGGCGCCGGCCACCGCATCCGCGCA
GCAGGCGTCAACGCCCCCGGCCGCGGCCGCCGCGCAGACAAAGCCGACGCAGCCGACCCAGCCCATCGCG
CCTGTTCAAGCACCAGCATCGTCCGAATCCCAGGGCGCGCCCAAGCCTGCACCCGCGGGCTCGGCGCTGA
CACCTTTGCCGACGCCTGCTGAGGCGGCCACGAGCTCACCCTCCGACGGTCGATCGGGCTCGGATGGCTC
GAACCTCATCGTTCTTCCATCGGGGGCGGTGGTCGACGGGGACACCGGTGAGGTCCAGGGCAAGGTCTCG
CCTCAAGATGGCCAATCTGACCGCGGTCAGTCCGGCTCGCTTGGCTTCGATGACCTGTTGAGGTAA