SecReT4
Protein ID: 300837078
T4SS name [ID]Tra_F [107]
Gene symboltraD
Locus tagpKP048_p139
StrainKlebsiella pneumoniae plasmid pKP048 (NC_014312)
Repliconplasmid pKP048 [GenBank: NC_014312] [Browse all T4SS(s) in this replicon]
Location [Strand]119540..121852 [+]
Productconjugal transfer protein TraD
Component typeTraD_F
UniProt IDD8L2R1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 9.2e-147, Aligned region: 172..561
TraD_N [PF12615], Evalue: 3e-32, Aligned region: 31..129
TraG-D_C [PF12696], Evalue: 9.3e-18, Aligned region: 419..541
AAA_10 [PF12846], Evalue: 6e-09, Aligned region: 400..491
T4SS-DNA_transf [PF02534], Evalue: 1.3e-06, Aligned region: 393..507
Protein Sequence: 770 a.a.     [Download]
>gi|300837078|ref|YP_003754132.1| conjugal transfer protein TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPEPVKAPPTIKRPAAEPSVRTTEPSVLRVTTVPLIKPKAAAAAAAASTASSSGAPATAAGGTQ
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF
 
Nucleotide Sequence: 2313 bp     [Download]
>gi|300836939|ref|NC_014312.1|:119540-121852 Klebsiella pneumoniae plasmid pKP048, complete sequence
ATGAGTTTCAATGCCAAAGATATGACGCAGGGCGGTCAGATCGCCAATATGCGCTTTCGCATGTTTGGTC
AGATTGCCAATATTATTTTCTACGTGCTGTTTATTTTATTCTGGGTGCTGTGCGGGCTGATGCTGATGTA
CCGGCTCAGCTGGCAAACCTTTGTGAACGGCTGCGTATACTGGTGGTGTACGACGCTGGGGCCGATGCGC
GATATTATTCGTTCCCAGCCGGTATACACCATTCAGTATTACGGCCAGTCGCTGGAATATACCTCAGAAC
AAATCCTGGCTGATAAATATACTATCTGGTGCGGAGAGCAGCTGTGGACCAGTTTCGTCTTTGCAGCCGT
GGTTTCTCTTGTTATCTGTATCGTGACGTTCTTCATCGCCAGCTGGGTGCTGGGCCGCCAGGGGAAACAG
CAGAGTGAGGATGAGAATACCGGCGGGCGCCAGCTTTCCGATAAGCCCAAAGAAGTGGCCCGCCAGATGA
AGCGTGATGGTATGGCCTCCGATATTAAAATTGGCGATCTGCCTATTCTTAAAAACTCCGAAATCCAGAA
CTTCTGCCTCCACGGTACCGTAGGCTCCGGTAAATCAGAAGTGATCCGCCGGCTACTGAACTACGTGCGT
GCACGTGGCGATATGGCCATCATTTATGATCGCTCCTGTGAGTTCGTCAAAAGCTATTATGACCCGTCAC
TGGATAAAATCCTCAACCCGCTGGATTCGCGCTGCGCGGCCTGGGATTTGTGGAAAGAGTGCCTGACGCT
GCCGGACTTCGACAACATCTCCAACACCCTTATCCCGATGGGTACCAAAGAAGACCCGTTCTGGCAGGGC
TCCGGTCGTACTATCTTTGCCGAAGGCGCGTACCTGATGCGTGAAGACAAGGATCGCAGCTACGAGAAGC
TGGTCGATACCATGCTGTCCATTAAAATCGACAAGCTGCGCGCCTATCTGCAGAACACGCCGGCAGCGAA
CCTGGTTGAAGAGAAAATTGAGAAAACGGCCATCTCCATTCGTGCCGTGCTGACCAACTACGTCAAGGCT
ATTCGCTACCTGCAGGGCATTGAGAAGAACGGCGAGCCGTTCACTATCCGGGACTGGATGCGCGGTGTCC
GTGAGGACCGACCCAATGGCTGGCTGTTTATCTCCTCCAACGCTGACACCCATGCTTCCCTGAAGCCGGT
TATCTCGATGTGGCTGTCAATTGCTATCCGCGGCCTGCTGGCGATGGGGGAGAACCGTAACCGGCGCGTG
TGGATTTTCGCCGACGAGCTCCCCACGCTGCACAAGCTGCCGGACCTGGTCGAAATCCTCCCGGAGGCGC
GTAAATTTGGTGGTTGTTATGTGTTCGGTATTCAGTCCTATGCCCAGCTGGAAGATATCTATGGCGTCAA
GCCTGCCGCCACGCTCTTTGACGTGATGAACACCCGGGCCTTCTTCCGCTCCCCGAGTAAGGAGATTGCG
GAGTTTGCTGCCGGTGAAATTGGTGAGAAGGAAATCCTCAAGGCCAGCGAGCAGTATTCTTACGGTGCTG
ACCCGGTGCGTGATGGTGTATCGACCGGGAAAGAAAAAGAGCGGGAAACGCTGGTCAGTTACTCCGATAT
TCAGACGCTGCCTGACCTGTCCTGCTATGTCACGCTGCCCGGGCCGTATCCGGCCGTGAAACTGGCCCTC
AAATACAAACCGCGTCCGAAAATTGCCGAGGGATTTATTCCTCGCACTCTCGATGCGCGGGTGGATGCGC
GGCTCAGTGCGTTGCTTGAAGCGCGGGAAGCTGAAGGCAGCCTTGCCAGGGCGCTTTTCACTCCGGATGC
GCCGGCATCCGGGCCCGCTGATACAAACAGTCACGCCGGTGAACAACCTGAGCCGGTCAGTCAGCCTGCG
CCAGCAGACATGACAGTATCTCCGGAACCGGTAAAAGCGCCGCCGACAATAAAGCGTCCGGCAGCGGAAC
CTTCCGTCAGAACAACGGAGCCTTCCGTCCTGCGGGTCACGACCGTACCGTTGATCAAACCAAAAGCAGC
CGCAGCGGCCGCTGCTGCCTCAACAGCATCCTCTTCCGGTGCCCCTGCAACAGCTGCAGGCGGGACACAA
CAGGAACTGGCGCAGCAGTCAGCGGAACAGGGACAGGACATGCTGCCGGCCGGCATGAACGAGGACGGCG
TCATCGAGGACATGCAGGCGTATGACGCCTGGCTGGCAGATGAGCAGACACAGCGGGATATGCAGCGGCG
TGAGGAAGTCAATATCAACCACAGCCACCGTCACGATGAGCAGGATGATGTCGAGATTGGAGGGAATTTC
TGA