SecReT4
Protein ID: 291286529
T4SS name [ID]Tra_F [602]
Gene symbol-
Locus tagDacet_0593
StrainDenitrovibrio acetiphilus DSM 12809
Repliconchromosome [GenBank: NC_013943] [Browse all T4SS(s) in this replicon]
Location [Strand]611871..613175 [-]
ProductDNA transfer in the process of conjugation and F pilus assembly protein
Component typeTraD_F
UniProt IDD4H478
KEGG IDdap:Dacet_0593
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.7e-14, Aligned region: 27..366
TraG-D_C [PF12696], Evalue: 4.2e-13, Aligned region: 289..400
TrwB_AAD_bind [PF10412], Evalue: 1.1e-12, Aligned region: 18..67
TrwB_AAD_bind [PF10412], Evalue: 1.1e-12, Aligned region: 322..375
T4SS-DNA_transf [PF02534], Evalue: 1.3e-06, Aligned region: 25..368
Protein Sequence: 434 a.a.     [Download]
>gi|291286529|ref|YP_003503345.1| DNA transfer in the process of conjugation and F pilus assembly protein [Denitrovibrio acetiphilus DSM 12809]
MKTILGTGMNIRGGRQQEIYMNDADRSGHFWCFGTTRVGKTRLLENMLEQDIRKGNSVVVIDPKGDIPLF
SKIYQAAKEAGREDDLMLITPIFPEYSIKLNPLEYYYMPEELVGHLISGIEVGSEPFFYNVAYETSLMIV
QAFMLLTEKAYGKRFNFNDVKDVVSHTDLTTLQRNVASLSSDNNDVIQLANDLQKIVDSGQDYYNKVSSS
LRVALMELTSGNIGEILGKARGNPVIEKLENGKSVILVAQVGSLMTRKAAFTVGKVLLSMFQSYVGRIFS
SGMKVDPPLEIFIDEAQNVLYYGIDDFFAKAGGANVHLHGLSQSVNQIYAMIGRDYGNSTLDNINNKLFM
KVPDEETASYVCRHFGTHKQMLSMMSSAGIINVRENEDDILKPEDVLGLKKREFFMMNYDGGFFGSTLDT
SEAYINIEYPRATV
 
Nucleotide Sequence: 1305 bp     [Download]
>gi|291285947|ref|NC_013943.1|:c613175-611871 Denitrovibrio acetiphilus DSM 12809 chromosome, complete genome
ATGAAAACTATCCTCGGAACTGGAATGAATATCCGTGGCGGGAGGCAGCAGGAAATATACATGAATGATG
CTGACCGGTCGGGGCATTTCTGGTGCTTCGGCACTACCAGAGTCGGCAAGACACGCCTGCTGGAAAACAT
GCTGGAACAGGACATCCGCAAAGGCAACAGCGTGGTTGTGATAGACCCGAAGGGGGATATCCCTCTTTTC
AGCAAGATATATCAGGCGGCGAAAGAGGCAGGTCGAGAGGATGACCTGATGCTCATCACACCAATCTTTC
CCGAGTACTCCATAAAGCTCAATCCGCTGGAATACTACTACATGCCGGAGGAGCTTGTTGGACACCTAAT
ATCCGGCATTGAGGTTGGTTCTGAGCCGTTTTTTTATAATGTGGCATATGAAACCAGCCTTATGATCGTT
CAGGCTTTTATGCTGCTCACAGAGAAAGCATACGGCAAACGATTCAATTTTAACGATGTCAAAGACGTTG
TCTCCCACACTGACCTGACAACACTTCAAAGGAACGTTGCAAGCCTCAGTAGTGATAACAATGATGTCAT
CCAGCTTGCAAATGACCTGCAAAAAATCGTGGACTCAGGTCAGGATTACTACAATAAAGTTTCAAGCTCA
TTACGTGTTGCACTGATGGAGCTGACGTCAGGCAACATTGGCGAAATTCTCGGCAAAGCCCGTGGAAATC
CCGTCATCGAAAAGCTGGAAAACGGTAAATCCGTGATACTGGTTGCACAGGTCGGCTCCCTGATGACACG
TAAGGCGGCGTTCACCGTGGGGAAAGTTCTTTTATCCATGTTTCAGTCTTATGTAGGGCGGATATTCAGC
AGCGGAATGAAAGTTGACCCTCCGCTGGAGATATTCATAGACGAGGCACAGAACGTGCTTTACTACGGGA
TTGATGACTTCTTTGCAAAAGCAGGCGGCGCAAATGTTCATTTGCACGGACTCAGTCAGTCAGTAAATCA
GATATACGCAATGATAGGCAGGGACTACGGGAACAGCACACTGGACAACATCAACAACAAGCTGTTCATG
AAAGTGCCGGACGAAGAGACTGCAAGCTATGTTTGCAGGCACTTCGGAACACATAAGCAGATGCTCTCCA
TGATGAGCTCCGCTGGGATTATAAATGTCCGTGAGAACGAAGACGACATACTCAAGCCTGAAGATGTTCT
GGGGCTGAAGAAACGTGAATTTTTCATGATGAACTATGACGGCGGATTCTTCGGAAGCACATTGGACACC
AGCGAGGCATATATAAATATCGAATATCCGAGGGCTACAGTATGA