SecReT4
Protein ID: 226810082
T4SS name [ID]Tra_F [571]
Gene symbol-
Locus tagpEC-IMPQ_209
StrainEnterobacter cloacae plasmid pEC-IMPQ (NC_012556)
Repliconplasmid pEC-IMPQ [GenBank: NC_012556] [Browse all T4SS(s) in this replicon]
Location [Strand]222136..224220 [+]
ProductTraG
Component typeTraD_F
UniProt IDC1IUU7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 6e-17, Aligned region: 199..582
TrwB_AAD_bind [PF10412], Evalue: 6.5e-15, Aligned region: 412..604
TraG-D_C [PF12696], Evalue: 9.8e-10, Aligned region: 505..617
Protein Sequence: 694 a.a.     [Download]
>gi|226810082|ref|YP_002791777.1| TraG [Enterobacter cloacae]
MSDSKRTNLHAQENFYRPILEYRSASILLICSVSMLYMGLSSDGLDIAPIVLFTSILLFLLCLYRCKTAA
PFLMAHWRVFKRHFMFVSLDSLRVINKSNFFSNERKYRQLVQDYQNKNKDIPERKSYFCDGFEWGPEHAD
RAYQIANLSSDKREIELPFVFNPIKRHFDAMARKMGGSNAIFAVERREPIFVTEDNWFGHTLITGNVGTG
KTVLQRLLSISMLHLGHVVVVIDPKNDAEWRESLMEEAKTLGLPFYKFHPGQPASSVCIDVCNTYTNVSD
LTSRLLSLVTVPGEVNPFVQYAKALVSNVISGLSYIEKKPSIYLIHKNMKSHMSIVNLTVKVMESCYARY
YGYDVWTEKVKYVANDTLPVRFKRLAEWFTAHFMNYEGSEQIDWLDTVSQLIDYSMSDPEHMAKMTAGIM
PVFDMLIEKPLNELLSPNPNSVSSREIVTSEGMFSTGGVLYISLDGLSNPDTAAAISQLIMSDLTSCAGS
RYNAQDGDMSANSRISIFVDEAHSAINNPMINLLAQGRAAKIALFICTQTISDFIAAASVETANRITGLC
NNYISLRVNDTPTQTLVVENFGKSAISTNMVTYTTGSETSLPHNNFSGSISERKQTTLEESIPKDLLGQV
PMFHIVARLQDGRKVVGQIPIAVAEKQMKPNTTLSEMLFKKAGKVTLRQNLDIKNLNKFLRKLH
 
Nucleotide Sequence: 2085 bp     [Download]
>gi|226809877|ref|NC_012556.1|:222136-224220 Enterobacter cloacae plasmid pEC-IMPQ, complete sequence
ATGTCAGATTCGAAGAGGACTAACCTCCATGCACAAGAGAATTTTTATCGGCCTATTCTTGAGTATCGTA
GTGCCTCAATACTTTTGATTTGTTCGGTTTCTATGCTTTATATGGGACTTTCTTCAGACGGACTGGACAT
CGCCCCAATAGTTCTGTTCACCTCAATATTGCTTTTTTTGCTGTGCCTTTATCGTTGCAAAACAGCAGCG
CCATTTTTGATGGCTCATTGGCGTGTATTCAAGCGACATTTCATGTTCGTTAGTCTTGATTCACTGCGTG
TAATTAACAAAAGTAACTTTTTCTCCAATGAGCGAAAGTATCGTCAACTGGTTCAGGATTATCAAAATAA
AAATAAGGATATACCCGAGCGAAAGTCCTATTTTTGTGATGGGTTTGAGTGGGGTCCGGAACATGCGGAT
CGGGCATATCAAATAGCTAACCTCTCCAGTGATAAACGTGAGATCGAGTTGCCATTCGTCTTCAACCCAA
TTAAGAGACATTTTGACGCAATGGCTCGTAAGATGGGCGGCAGCAATGCAATTTTTGCTGTGGAACGTAG
GGAACCCATATTTGTAACTGAAGACAATTGGTTTGGTCATACTCTGATAACCGGAAACGTGGGTACCGGG
AAAACGGTGCTACAGCGTTTACTAAGCATTAGCATGCTTCATCTTGGTCATGTTGTTGTTGTCATAGATC
CAAAGAACGATGCAGAGTGGCGAGAATCTCTAATGGAAGAGGCTAAGACCCTCGGTCTTCCTTTCTATAA
ATTTCATCCTGGCCAGCCAGCATCTTCGGTCTGTATTGATGTCTGCAACACCTATACTAATGTTTCTGAC
CTAACATCTCGTCTTTTGAGCTTGGTGACAGTTCCCGGTGAGGTTAACCCATTCGTTCAGTATGCCAAGG
CTCTCGTTTCCAATGTGATTTCCGGGCTTTCTTACATAGAGAAAAAGCCTTCTATTTATCTGATTCACAA
GAACATGAAAAGCCACATGTCTATTGTGAATCTTACAGTCAAGGTAATGGAGTCATGTTACGCGAGATAT
TATGGTTACGATGTCTGGACCGAAAAAGTTAAGTACGTCGCTAACGATACCTTGCCGGTACGTTTCAAGC
GTCTCGCTGAATGGTTTACGGCTCATTTCATGAATTACGAGGGGTCCGAACAAATAGACTGGTTAGATAC
TGTTTCCCAGCTTATTGATTACTCAATGTCCGACCCAGAGCATATGGCTAAAATGACCGCAGGTATTATG
CCTGTTTTCGATATGCTCATTGAAAAACCTTTAAATGAGCTTTTATCTCCTAACCCGAACTCAGTATCAT
CAAGAGAAATTGTAACAAGCGAAGGGATGTTCAGCACTGGCGGGGTGCTATACATTTCGCTTGATGGCCT
TTCAAACCCCGATACAGCAGCTGCTATTTCTCAATTAATAATGTCAGATCTGACCTCCTGTGCCGGTAGT
CGCTACAACGCTCAAGATGGTGATATGTCAGCTAATTCCAGGATAAGTATTTTTGTTGATGAGGCACACT
CAGCCATTAACAACCCTATGATTAACCTTCTGGCGCAGGGTCGTGCAGCGAAAATTGCACTGTTTATTTG
CACCCAAACCATCTCCGACTTTATTGCTGCGGCAAGTGTTGAAACTGCCAATCGAATTACGGGGCTCTGC
AACAATTATATAAGCTTGCGAGTCAACGATACTCCTACTCAGACGCTTGTTGTAGAGAACTTTGGTAAGA
GTGCGATAAGCACAAATATGGTCACTTATACGACCGGTTCAGAAACATCTTTGCCGCATAATAACTTCTC
AGGTTCAATCTCAGAAAGAAAGCAGACAACTTTAGAAGAGAGTATTCCAAAGGATCTCTTGGGTCAGGTC
CCTATGTTTCACATAGTTGCCAGGCTTCAAGATGGCAGGAAGGTTGTAGGCCAAATCCCTATTGCTGTTG
CTGAGAAACAAATGAAGCCAAACACAACTCTGTCGGAAATGCTTTTCAAGAAGGCCGGAAAAGTTACTTT
GCGTCAAAATCTCGATATCAAAAATCTTAATAAATTTCTAAGGAAGTTGCATTGA