SecReT4
Protein ID: 189348800
T4SS name [ID]Tra_F [805]
Gene symboltraD
Locus tagBMULJ_06216
StrainBurkholderia multivorans ATCC 17616
Repliconplasmid pTGL1 [GenBank: NC_010802] [Browse all T4SS(s) in this replicon]
Location [Strand]60461..62488 [-]
Producttype IV secretion system protein
Component typeTraD_F
UniProt IDA9ATZ0
KEGG IDbmj:BMULJ_06216, bmu:Bmul_6203
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 8.8e-104, Aligned region: 178..561
TraG-D_C [PF12696], Evalue: 3.8e-14, Aligned region: 421..542
AAA_10 [PF12846], Evalue: 5.5e-10, Aligned region: 397..502
T4SS-DNA_transf [PF02534], Evalue: 7.4e-08, Aligned region: 372..501
Protein Sequence: 675 a.a.     [Download]
>gi|189348800|ref|YP_001941995.1| type IV secretion system protein [Burkholderia multivorans ATCC 17616]
MTEKVISDAGAGRALFMTRVKLTVHAASMAFFVGALPAMVLPSVWWMNTLTAHDVDLVKANILSHVVDQE
VPRRWRIRDGVGEKKILTVVKSDGELAQWLTPPQFRNVVPDLARPVTAFRYVAWVSVGLGAAGYYAVWRS
LARLGRRARENKRVDGALDVVSAEELSKAVRREEAGPYTVLDVALPRSAPMQGIMFVGAQGTGKSLGIHD
LMGQVFARGRKSVIYDHAGEYFRAYYRPGKDLFFNPALLGSVPWSMFMEMENTYDSDTLAHAFLPPKAGV
VHGASAFFEDAARVLFSVMALRLRQRGAVYTRLISEAILSMPEDELELLIKNSVASSAVGGDSKGQRQGV
ISSIAIYLNGIAAVQDGTWTLREFYEKDDDTRLFLIGTEDTYAMFAPLFRLLITMAFQTIAARREIRHED
RYWFFLDETHVLGDIKLDARQAELRKYGVCVAAGIQADKQFNTSMGADRAETLMNCFNTTVTLRLNEPNM
QERMARRLGKSETAVVRAGQAIAVTDWRDGGQLSQDEREKWVVMPSKIGLLKNCMAYVQVAGDFPPALVN
YRHWLPRWYRPWPRTLRFRERQPDPPRDPRFKISAADGQDAIESVRAEAEAMKAQAAAAAAAAATSPTAA
VTTQGKWIVTDLDTGEVMLPTADVGRGDEHSDGREPVSQENEGLF
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|189348761|ref|NC_010802.1|:c62488-60461 Burkholderia multivorans ATCC 17616 plasmid pTGL1, complete sequence
ATGACCGAAAAGGTAATCTCCGATGCCGGCGCGGGACGCGCGCTTTTCATGACTCGGGTCAAGCTGACTG
TCCATGCTGCCTCGATGGCATTTTTTGTCGGGGCGTTGCCGGCGATGGTTCTGCCGAGCGTCTGGTGGAT
GAACACGCTTACTGCTCATGATGTCGACCTCGTTAAGGCCAATATCTTGTCCCACGTCGTCGATCAGGAG
GTACCGCGACGCTGGCGGATTCGCGATGGTGTTGGGGAGAAAAAGATCCTCACCGTCGTCAAATCCGACG
GCGAGCTCGCCCAGTGGTTAACTCCCCCTCAGTTTAGGAACGTTGTACCCGACCTTGCTCGGCCAGTCAC
GGCATTCCGATATGTCGCGTGGGTCAGCGTCGGACTTGGTGCGGCCGGCTATTACGCGGTTTGGCGGTCC
CTTGCGCGGCTCGGTCGGCGGGCTCGTGAGAACAAGCGCGTCGACGGAGCGTTGGACGTCGTCTCGGCTG
AAGAGCTGTCGAAAGCTGTACGCCGCGAGGAGGCGGGGCCGTATACCGTCCTTGACGTGGCCCTTCCTCG
ATCTGCGCCGATGCAGGGCATTATGTTTGTCGGGGCGCAAGGAACAGGCAAATCGTTGGGTATTCACGAT
CTTATGGGCCAGGTGTTCGCGCGCGGCCGAAAGTCGGTAATTTACGATCATGCCGGCGAATACTTTCGAG
CGTACTACCGTCCCGGAAAAGACCTGTTCTTTAATCCCGCCCTGCTTGGCTCGGTCCCTTGGTCGATGTT
CATGGAGATGGAGAACACCTACGATTCGGACACGCTTGCACACGCATTCTTGCCGCCTAAGGCGGGGGTC
GTGCATGGTGCGAGCGCATTCTTTGAGGACGCAGCGCGAGTGCTATTTTCGGTGATGGCCTTACGCTTGC
GTCAACGCGGGGCGGTCTATACCCGCCTGATTTCCGAGGCCATCCTTTCCATGCCGGAGGACGAGCTTGA
GCTCTTGATCAAGAATTCTGTTGCGAGCTCGGCAGTCGGCGGCGACTCCAAGGGGCAGCGTCAAGGGGTG
ATCAGTTCAATCGCCATCTACTTGAACGGAATCGCCGCGGTTCAGGACGGCACTTGGACGCTCCGCGAGT
TCTACGAAAAGGACGACGACACGCGACTTTTCCTCATCGGCACCGAGGACACGTATGCGATGTTCGCACC
GCTATTTCGCCTCTTGATCACGATGGCATTTCAGACGATTGCCGCGCGCCGGGAAATTCGTCACGAGGAC
CGCTATTGGTTTTTTCTTGATGAAACGCATGTCCTTGGTGACATCAAGCTGGACGCCCGGCAAGCGGAGT
TGCGGAAGTACGGGGTTTGCGTCGCCGCTGGCATTCAAGCAGACAAGCAGTTCAATACGTCCATGGGTGC
GGACCGCGCCGAAACGCTAATGAACTGCTTCAACACCACTGTTACGCTCCGTCTCAATGAACCGAACATG
CAGGAGCGAATGGCGCGGCGCTTGGGGAAGAGTGAGACAGCCGTAGTCAGGGCGGGACAGGCGATCGCCG
TGACCGATTGGCGTGACGGGGGGCAGCTTAGCCAGGACGAGCGCGAAAAGTGGGTGGTCATGCCATCGAA
GATTGGGTTGCTGAAAAACTGCATGGCATACGTTCAGGTTGCCGGTGACTTTCCGCCGGCATTGGTGAAC
TACCGCCACTGGCTACCTCGATGGTATCGACCGTGGCCACGAACCTTGCGATTCCGCGAGAGGCAGCCGG
ACCCGCCACGCGATCCGCGGTTCAAGATATCCGCCGCGGATGGTCAAGATGCGATAGAAAGCGTCCGGGC
CGAGGCGGAAGCAATGAAGGCCCAAGCTGCTGCAGCGGCAGCGGCAGCGGCAACCAGTCCGACGGCGGCC
GTAACGACGCAGGGAAAGTGGATCGTCACCGATCTAGACACTGGCGAAGTGATGCTTCCGACAGCCGACG
TCGGGCGTGGCGATGAACATAGCGACGGTCGAGAGCCGGTCTCGCAAGAAAATGAGGGGTTGTTCTGA