SecReT4
Protein ID: 189184044
T4SS name [ID]Tra_F [564]
Gene symbol-
Locus tagOTT_1137
StrainOrientia tsutsugamushi str. Ikeda
Repliconchromosome [GenBank: NC_010793] [Browse all T4SS(s) in this replicon]
Location [Strand]1169124..1170878 [-]
Productconjugative transfer protein TraD
Component typeTraD_F
UniProt IDB3CQV2
KEGG IDott:OTT_1137, ott:OTT_0401, ott:OTT_1484
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 2.8e-132, Aligned region: 180..560
TraD_N [PF12615], Evalue: 1.6e-27, Aligned region: 28..137
TraG-D_C [PF12696], Evalue: 1.1e-20, Aligned region: 420..542
T4SS-DNA_transf [PF02534], Evalue: 1.3e-17, Aligned region: 335..555
AAA_10 [PF12846], Evalue: 8.9e-09, Aligned region: 420..496
T2SE [PF00437], Evalue: 1.5e-05, Aligned region: 191..228
Protein Sequence: 584 a.a.     [Download]
>gi|189184044|ref|YP_001937829.1| conjugative transfer protein TraD [Orientia tsutsugamushi str. Ikeda]
MNFQNQGNFTRGSQLFAHKLRMFGQGSTNVFIIGLGLSIFWIICRLYQKVFLSSLYYFVIERYVQLKLAI
GEHFYDIDQIGIKFYSLRFKKWMHLNAQDFLHEFYTSQHGFKIQQLLEFLINSALLEGLIVFAIGVIISI
VFFTAQGKNTIIKAKIRGADFVECKCLSKMLKSAKKASKICFGGLPLVKNSERLHILITGTTGTGKTNML
NELLPQIRLHKDRAIIVDTTGAFTDRFFDSKCDKLLNPLEKNSEQWLPWNDCFEAANFHDIASSFSNYTP
KLDDFFAKNAELVLSEALKLYQDDKDIIKLIHTIIYSDNRQFAKAFRNTAVSGIISESALETSAGIQSTL
GKNITSLQYLKPGGSFSIKEWFSNSNETGWLFITATPSQRATLCPLISAWISIAIKALMCRNPNHDNKNM
WFILDELPALQKVSSLPVALAESRKYGGCFVAVLQNIHQLEAIYGAAECASMLDLFNSKFIFRVSDQVTA
YKSALTLGEQEIIETQENLSYGSNTMRDGVNMNNVERKKILVMPSEIMNLPDLTCYVKLAGNFPITKLTM
QLQNLNTAFVCEYKLLKKLKLVEY
 
Nucleotide Sequence: 1755 bp     [Download]
>gi|189182907|ref|NC_010793.1|:c1170878-1169124 Orientia tsutsugamushi str. Ikeda, complete genome
ATGAATTTTCAGAATCAAGGAAATTTCACCAGAGGATCGCAGTTATTTGCCCATAAGTTAAGAATGTTTG
GGCAAGGTAGTACCAACGTTTTTATAATTGGATTAGGATTATCGATATTCTGGATTATATGTCGATTATA
TCAAAAAGTTTTTCTGAGCAGCTTGTATTATTTTGTAATTGAAAGATATGTGCAGCTTAAGCTAGCAATT
GGTGAGCACTTTTATGATATCGATCAAATAGGCATTAAGTTTTATAGTTTAAGGTTTAAAAAATGGATGC
ACCTCAATGCTCAAGACTTTTTGCATGAATTTTATACAAGCCAACATGGATTTAAAATACAGCAATTATT
GGAATTCTTAATTAATTCAGCATTGTTAGAAGGATTAATTGTTTTTGCTATTGGTGTGATAATCTCAATT
GTTTTCTTTACAGCTCAAGGCAAAAACACGATTATTAAGGCCAAAATTAGAGGTGCTGATTTTGTAGAGT
GCAAATGCCTATCTAAAATGCTAAAAAGCGCTAAAAAGGCCTCGAAAATCTGTTTTGGAGGCTTGCCATT
AGTAAAGAATAGTGAAAGATTACATATTCTGATTACTGGAACAACAGGTACTGGTAAAACTAATATGCTT
AACGAACTGCTACCACAAATTCGATTACATAAAGATCGAGCAATAATTGTAGATACAACTGGAGCTTTTA
CTGATAGATTTTTTGATTCTAAATGTGATAAGCTGCTTAATCCTTTGGAAAAAAATAGTGAGCAATGGTT
GCCTTGGAATGATTGTTTTGAAGCAGCTAATTTTCATGATATAGCTAGTAGTTTTAGTAATTATACTCCT
AAACTTGATGACTTTTTTGCTAAAAATGCTGAATTAGTCTTATCTGAAGCATTGAAGCTATATCAGGATG
ATAAAGATATCATAAAACTAATTCATACAATCATTTACTCTGATAATAGACAATTTGCAAAAGCTTTTAG
AAACACAGCTGTATCAGGTATTATAAGCGAAAGTGCGCTTGAAACTTCTGCAGGAATTCAGTCTACTCTT
GGAAAGAATATTACTTCGCTACAATATTTAAAGCCTGGAGGTAGTTTTAGCATCAAGGAATGGTTTAGTA
ATTCGAATGAAACTGGCTGGCTATTTATCACAGCTACCCCAAGTCAAAGAGCTACTTTATGCCCACTTAT
TTCAGCCTGGATAAGCATAGCTATCAAGGCTTTGATGTGTAGAAATCCTAATCATGATAACAAAAACATG
TGGTTTATACTTGATGAATTGCCAGCTCTACAAAAAGTTTCATCTTTACCAGTTGCTTTAGCTGAAAGTA
GAAAGTATGGAGGCTGCTTTGTTGCTGTATTGCAGAACATTCATCAATTAGAAGCAATATATGGGGCTGC
TGAATGTGCTTCTATGCTGGATTTGTTTAATAGTAAATTTATTTTTCGAGTTAGTGATCAGGTTACAGCT
TATAAGTCAGCATTAACACTAGGTGAGCAAGAAATTATTGAAACTCAAGAGAACTTGTCATATGGATCAA
ATACTATGCGAGATGGGGTAAATATGAATAATGTTGAGCGTAAAAAGATTTTAGTTATGCCATCTGAAAT
TATGAACCTACCAGACTTAACTTGTTATGTAAAACTTGCTGGTAACTTTCCTATCACAAAACTAACTATG
CAGCTACAAAACTTAAATACAGCTTTTGTTTGTGAATATAAATTGCTCAAAAAACTTAAGTTAGTAGAGT
ATTAA