[1] Carraro N et al (2016) IncA/C Conjugative Plasmids Mobilize a New Family of Multidrug Resistance Islands in Clinical Vibrio cholerae Non-O1/Non-O139 Isolates from Haiti. mBio. 7(4):e00509-16. [PMID:27435459] |
[2] Rivard N et al (2020) Antibiotic Resistance in Vibrio cholerae: Mechanistic Insights from IncC Plasmid-Mediated Dissemination of a Novel Family of Genomic Islands Inserted at trmE. mSphere. 5(4):e00748-20. [PMID:32848007] |
ID | 1068 |
Name | MobI_MGIVchHai6 |
GenBank accession number | ERP70969 |
Family | Other |
Length | 264 aa |
UniProt ID | _ |
PDB ID | _ |
Pfam | MobI [PF19456.2], Evalue: 1E-34, Aligned region: 1..264 |
Note | putative relaxase |
Protein sequence [Download] | MAKASQQKTRVPQKGTKAGDELTHETIDSLCIQHTVDYVMTKNYSFLEQQIVAFGAALNR GNQPQSEYIEAFSKSFKGLETQINIWETFIANSTNVNQDDAMLFSLSVSEQYLRYTHKSI EIEQIRYYYIAQKIADLFWQHNREHRGKNSPGYPGHFGCRVRLRNKKLEIFWVYNQFKPK KNSDGFQVISHYLPRDGHFRYPKTTFTRAQDWEKPVIEVVEDAFAIIRRTNANLMRIRQL CRWNNDNLYKMAGEIDDFKMDNPL |
[1] Rivard N et al (2020) Antibiotic Resistance in Vibrio cholerae: Mechanistic Insights from IncC Plasmid-Mediated Dissemination of a Novel Family of Genomic Islands Inserted at trmE. mSphere. 5(4):e00748-20. [PMID:32848007] |
ID | 87 |
Element type | IME |
ICE description | MGIVchHai6 |
ICEberg accesion number | 172_IME |
GenBank accession number | AXDR01000001 |
Family | |
Genome size | 47437 |
Coordinate of oriT [+/-] | 43098..91582 |
Drug resistance | Antibiotic resistance genes: sul1 floR, tetA(G), tetR, floR |
Heavy-metal resistance | Heavy-metal resistance genes: merR, merP, merA |
Virulence factor | Virulence genes: RhuM |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Vibrio cholera non-01/non-0139 HC-36A1 [156539] |
[1] Rivard N et al (2020) Antibiotic Resistance in Vibrio cholerae: Mechanistic Insights from IncC Plasmid-Mediated Dissemination of a Novel Family of Genomic Islands Inserted at trmE. mSphere. 5(4):e00748-20. [PMID:32848007] |
[2] Carraro N et al (2016) IncA/C Conjugative Plasmids Mobilize a New Family of Multidrug Resistance Islands in Clinical Vibrio cholerae Non-O1/Non-O139 Isolates from Haiti. mBio. 7(4):e00509-16. [PMID:27435459] |