[1] Ceccarelli D et al (2008) Identification of the origin of transfer (oriT) and a new gene required for mobilization of the SXT/R391 family of integrating conjugative elements. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
[2] Wozniak RA et al (2009) Comparative ICE genomics: insights into the evolution of the SXT/R391 family of ICEs. PLoS Genet. 5(12):e1000786. [PMID:20041216] |
ID | 271 |
Name | TraI_R391 |
GenBank accession number | AAM08003 |
Family | MOBH |
Length | 716 aa |
UniProt ID | Q8RL15 |
PDB ID | _ |
Pfam | TraI_2 [PF07514.10], Evalue: 1.50E-121, Aligned region: 32..355 |
Note | _ |
Protein sequence [Download] | MFKNLFFQTKALPELSSQLDADIPRYPPFLKGLPAASPEDLQSTQDELIAKLRQVLGFNQ RDFQRLIQPCIDHLAAYVHLLPASEHHHHSGAGGLLRHSLEVAFWAAQAAEGIIFVASGT PVEKKELEPRWRVAAALGGLFHDIGKPVSDLSITDEDGRYQWNPFLETLSQWTTNNSIER YFIRWRDGRCKRHEQFSILVLNRVMTPELLAWLTQPGPEILQAMLEAIGNTDLEHVLSKL VIEADQTSVQRDLKAQRISVDDNALGVPVERYLLDAMRRLLASSQWLVNQRDARVWLRKS NQSTHLYLVWKSAAKDIIELLAKDKIPGIPRDPDTLADILIERGLATKSASNERYESLAP EVLIKDDKPIWLPMLHISEADLLFSSNVPSSVRLFSKSEWEATRQTQAEPQSRSSEHSDL PEASSSIEHRKSTESPSTNSSEQDDELRLASDVNNPQATENAPGDGCEKPNNSYDGAISN NVNQYDTEALNLPESLAWLPEASSALVMVGEQILIRYPDAVRPWCAPRKLLAELSQLDWL ELDPANPTRKARTVTTNDGVQEQGLLLKVSISKRLIALIDISKQGTEPAAAIQNEEALQR PSRTKTTNAQAKEPATRAERKQKPIAPNAKSSTDPKYVQRQQMVNFVKDLPILLTDGDYP DVDHSADGIRVTIQTLRQVANAHGIPAGQLLRGISASDECQFDEGETVLFTAHAKR |
[1] Ceccarelli D et al (2008) Identification of the origin of transfer (oriT) and a new gene required for mobilization of the SXT/R391 family of integrating conjugative elements. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
# | ID | Name | GenBank | Length | Note |
1 | 360 | _ |
ID | 271 |
Name | TraD_R391 |
SecReT4 accesion number | _ |
GenBank accession number | AAM08004 |
Family | TrwB/TraD |
Length | 606 |
UniProt ID | Q8RL14 |
PDB ID | _ |
Pfam | TrwB_AAD_bind [PF10412.8], Evalue: 6.50E-10, Aligned region: 146..375 TrwB_AAD_bind [PF10412.8], Evalue: 1.40E-05, Aligned region: 406..592 TraG-D_C [PF12696.6], Evalue: 2.20E-12, Aligned region: 451..579 AAA_10 [PF12846.6], Evalue: 7.60E-08, Aligned region: 146..291 DUF87 [PF01935.16], Evalue: 4.60E-05, Aligned region: 152..231 |
Note | putative coupling protein involved in conjugal transfer |
Protein sequence [Download] |
[1] Ceccarelli D et al (2008) Comparative ICE genomics: insights into the evolution of the SXT/R391 family of ICEs. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
ID | 65 |
Element type | Conjugative genomic island R391 |
ICE description | R391 |
ICEberg accesion number | 43 |
GenBank accession number | AY090559.1 |
Family | SXT/R391 |
Genome size | 88532 bp |
Coordinate of oriT [+/-] | 5428..5726 [+] |
Drug resistance | kanamycin resistance |
Heavy-metal resistance | mercury resistance |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Providencia rettgeri [587] |
[1] Ceccarelli D et al (2008) Identification of the origin of transfer (oriT) and a new gene required for mobilization of the SXT/R391 family of integrating conjugative elements. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
[2] Peters SE et al (1991) Novel mercury resistance determinants carried by IncJ plasmids pMERPH and R391. Mol Gen Genet. 228(1-2):294-9. [PMID:1886614] |