[1] Peters SE et al (1991) Novel mercury resistance determinants carried by IncJ plasmids pMERPH and R391. Mol Gen Genet. 228(1-2):294-9. [PMID:1886614] |
[2] Wozniak RA et al (2009) Comparative ICE genomics: insights into the evolution of the SXT/R391 family of ICEs. PLoS Genet. 5(12):e1000786. [PMID:20041216] |
[3] Daccord A et al (2010) Integrating conjugative elements of the SXT/R391 family trigger the excision and drive the mobilization of a new class of Vibrio genomic islands. Mol Microbiol. 78(3):576-88. [PMID:20807202] |
ID | 270 |
Name | TraI_SXT(MO10) |
GenBank accession number | AAL59675 |
Family | MOBH |
Length | 716 aa |
UniProt ID | Q8KQY3 |
PDB ID | _ |
Pfam | TraI_2 [PF07514.10], Evalue: 3.10E-121, Aligned region: 32..355 |
Note | conjugative relaxase |
Protein sequence [Download] | MFKNLFFQAKALPDLSSQLDAEIPRYPPFLKGLPAASPEDLQSTQDELIAKLRQVLGFNL RDFQRLIQPCIDHLAAYVHLLPASEHHHHSGAGGLLRHSLEVAFWAAQAAEGIIFVASGT PVEKKELEPRWRVAAALGGLFHDIGKPVSDLSITDEDGRYQWNPFLETLSQWTTNNSIER YFIRWRDGRCKRHEQFSILVLNRVMTPELLAWLTQPGPEILQAMLEAIGNTDPEHVLSKL VIEADQTSVQRDLKAQRISVDDNALGVPVERYLLDAMRRLLASSQWLVNQRDARVWLRKS NQSTHLYLVWKSAAKDIIELLAKDKIPGIPRDPDTLADILIERGLATKSASNERYESLAP EVLIKDDKPIWLPMLHISEADLLFSSNVPSSVRLFSKSEWEATQKTQEEPQSHSSEHSDL PEASSSIEHRKSDESPSTNSSEQENELRHASDVSNPQATENAPGDECEKPNDSSDADIAN NANQHHAEALNLPESLAWLPEASSALVMVGEQVLIRYPDAVRHWCAPRKLLAELSRLDWL ELDPANLTRKARTVTTNDGVQEQGLLLKVSISKGLTALIDLPKQDAEPAAAIQNEEALQR PSRTETTNAQAKEPATRAERKQKPIAANTNSSTDPKHAQRQQMVNFVKDLPILLTDGDYP DVDHSADGIRVTIQTLRQVANAHGIPAGQLLRGISASDQCQFDEGETVLFTAHAKR |
[1] Ceccarelli D et al (2008) Identification of the origin of transfer (oriT) and a new gene required for mobilization of the SXT/R391 family of integrating conjugative elements. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
# | ID | Name | GenBank | Length | Note |
1 | 359 | _ |
ID | 270 |
Name | TraD_SXT(MO10) |
SecReT4 accesion number | _ |
GenBank accession number | AAL59680 |
Family | TrwB/TraD |
Length | 599 |
UniProt ID | Q8KQY2 |
PDB ID | _ |
Pfam | TrwB_AAD_bind [PF10412.8], Evalue: 6.40E-10, Aligned region: 139..367 TrwB_AAD_bind [PF10412.8], Evalue: 1.30E-05, Aligned region: 399..585 TraG-D_C [PF12696.6], Evalue: 2.60E-12, Aligned region: 444..572 AAA_10 [PF12846.6], Evalue: 7.50E-08, Aligned region: 139..284 DUF87 [PF01935.16], Evalue: 4.50E-05, Aligned region: 145..224 |
Note | _ |
Protein sequence [Download] |
[1] Ceccarelli D et al (2008) Integrating conjugative elements of the SXT/R391 family trigger the excision and drive the mobilization of a new class of Vibrio genomic islands. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
ID | 64 |
Element type | contains SXT transposon-like element |
ICE description | SXT(MO10) |
ICEberg accesion number | 44 |
GenBank accession number | AY055428.1 |
Family | SXT/R391 |
Genome size | 99483 bp |
Coordinate of oriT [+/-] | 3516..3814 [+] |
Drug resistance | resistance to trimethoprim, sulfamethoxazole, streptomycin, and furazolidone |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Vibrio cholerae O139 MO10 [666] |
[1] Ceccarelli D et al (2008) Identification of the origin of transfer (oriT) and a new gene required for mobilization of the SXT/R391 family of integrating conjugative elements. J Bacteriol. 190(15):5328-38. [PMID:18539733] |
[2] Waldor MK et al (1996) A new type of conjugative transposon encodes resistance to sulfamethoxazole, trimethoprim, and streptomycin in Vibrio cholerae O139. J Bacteriol. 178(14):4157-65. [PMID:8763944] |
[3] Daccord A et al (2010) Integrating conjugative elements of the SXT/R391 family trigger the excision and drive the mobilization of a new class of Vibrio genomic islands. Mol Microbiol. 78(3):576-88. [PMID:20807202] |