[1] Tribble GD et al (1997) The Bacteroides mobilizable transposon Tn4555 integrates by a site-specific recombination mechanism similar to that of the gram-positive bacterial element Tn916. J Bacteriol. 179(8):2731-9. [PMID:9098073] |
[2] Vedantam G et al (2006) Bacteroides fragilis mobilizable transposon Tn5520 requires a 71 base pair origin of transfer sequence and a single mobilization protein for relaxosome formation during conjugation. Mol Microbiol. 59(1):288-300. [PMID:16359335] |
[3] Smith CJ et al (1998) The transfer origin for Bacteroides mobilizable transposon Tn4555 is related to a plasmid family from gram-positive bacteria. J Bacteriol. 180(2):435-9. [PMID:9440538] |
[4] Grohmann E et al (2003) Conjugative plasmid transfer in gram-positive bacteria. Microbiol Mol Biol Rev. 67(2):277-301. [PMID:12794193] |
[5] Grohmann E et al (1999) Mobilisation of the streptococcal plasmid pMV158: interactions of MobM protein with its cognate oriT DNA region. Mol Gen Genet. 261(4-5):707-15. [PMID:10394908] |
ID | 222 |
Name | MobA_Tn4555 |
GenBank accession number | AAD43599 |
Family | MOBV |
Length | 519 aa |
UniProt ID | Q9XBG8 |
PDB ID | _ |
Pfam | |
Note | relaxase |
Protein sequence [Download] | MTHSGRFSPENPEQRVTLSLQSPLMGCTPKNPMRLRTAEKQTIKYKPKKQVSMATKSSIH IKPCNIASSEAHNRRTAEYMRHIGESRTYVVPELSTDNEQWINPDFGSPDLRMHYDNIRQ MVKEKTGRAMQEKERERKGKNGKIVKIAGCSPIREGVLLVRSDTTLADVRKFGEECQRRW GITPLQIFLHKDEGHWLNGQPEAEDRESFKVGDRWFKPNYHAHIVFDWMNHETGKSRKLN DDDMMQMQTLASDILLMERGQSKAVTGKEHLERNDFIIEKQKAELQRMDAAKRHKEEQIN LAEQELKQVKSEIRTDKLKKTATTAATAITSGVASLFGSGKLKELERANEKLQDEVSKRN TNIEKLQSQVQQMSETAYTQIHNLREMHRQELDMKEKELSRLARIIDKAFRWFPMFREML RMEKFCAMLGFSKEMTESLIVKKEALKCSGKIYSEQHRRNFDIKDDILRVENDPDDESRL NLTINRKPIADWFREQWHRLRYGARVPQQEERKSRGFKL |
[1] Smith CJ et al (1996) A gene product related to Tral is required for the mobilization of Bacteroides mobilizable transposons and plasmids. Mol Microbiol. 20(4):741-50. [PMID:8793871] |
[2] Tribble GD et al (1997) The Bacteroides mobilizable transposon Tn4555 integrates by a site-specific recombination mechanism similar to that of the gram-positive bacterial element Tn916. J Bacteriol. 179(8):2731-9. [PMID:9098073] |
[3] Smith CJ et al (1998) The transfer origin for Bacteroides mobilizable transposon Tn4555 is related to a plasmid family from gram-positive bacteria. J Bacteriol. 180(2):435-9. [PMID:9440538] |
# | ID | Name | GenBank | Length | Note |
1 | 310 | _ |
ID | 13 |
Element type | IME (Mobilizable transposon); beta-lactamase transposon Tn4555 |
ICE description | Tn4555 |
ICEberg accesion number | _ |
GenBank accession number | U75371.3 |
Family | _ |
Genome size | 12105 bp |
Coordinate of oriT [+/-] | 6390..6563 [+] |
Drug resistance | resistance to cefoxitin (the beta-lactamase gene cfxA) |
Heavy-metal resistance | _ |
Virulence factor | _ |
Xenobiotic degradation | _ |
Host bacterium [NCBI Taxonomy ID] | Bacteroides fragilis [817] |
[1] Tribble GD et al (1997) The Bacteroides mobilizable transposon Tn4555 integrates by a site-specific recombination mechanism similar to that of the gram-positive bacterial element Tn916. J Bacteriol. 179(8):2731-9. [PMID:9098073] |