Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105186
Name   oriT_pRHBSTW-00039_3 in_silico
Organism   Klebsiella grimontii strain RHBSTW-00039
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP058182 (61188..61236 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pRHBSTW-00039_3
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3540 GenBank   WP_064386203
Name   traD_HV042_RS29920_pRHBSTW-00039_3 insolico UniProt ID   _
Length   772 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 772 a.a.        Molecular weight: 86585.38 Da        Isoelectric Point: 5.0283

>WP_064386203.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella/Raoultella group]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFIIFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTINYYGKSLEYNSEQILADKYTIWCGEQLWTSFVFAAIVSLTVCIVTFFVASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKHSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDIWRECLTLPDFDNVSNTLIPMGTKEDPFWQG
SGRTIFSEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLKNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLGMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDVQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIQRNLDTRVDARLNALLEAREAEGSLARTLFTPDAPAPELAEKDEKVGNPPEQSQPAE
SSGTSATVKVPSTAKTPEADESGQSPEVSNPAALLTKVVTVPLTRPRPAAATGTAAVASATDVPATPAGG
TEQALETQPAEQGQDMLPPGVNEYGEIDDMHAWDEWQSGEQTQRDMQRREEVNINHSHRRDEQDDIEIGG
NF

  Protein domains


Predicted by InterproScan.

(32-128)

(172-560)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 63615..92209

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HV042_RS29730 (HV042_29740) 60056..60598 + 543 WP_053390246 antirestriction protein -
HV042_RS29735 (HV042_29745) 60621..61043 - 423 WP_077268549 transglycosylase SLT domain-containing protein -
HV042_RS29740 (HV042_29750) 61547..61939 + 393 WP_181334957 conjugal transfer relaxosome DNA-binding protein TraM -
HV042_RS31310 62177..62878 + 702 WP_223174962 hypothetical protein -
HV042_RS29750 (HV042_29760) 62964..63164 + 201 WP_048289787 TraY domain-containing protein -
HV042_RS29755 (HV042_29765) 63233..63601 + 369 WP_064343525 type IV conjugative transfer system pilin TraA -
HV042_RS29760 (HV042_29770) 63615..63920 + 306 WP_064343526 type IV conjugative transfer system protein TraL traL
HV042_RS29765 (HV042_29775) 63936..64502 + 567 WP_064359954 type IV conjugative transfer system protein TraE traE
HV042_RS29770 (HV042_29780) 64489..65223 + 735 WP_064343528 type-F conjugative transfer system secretin TraK traK
HV042_RS29775 (HV042_29785) 65223..66644 + 1422 WP_053390199 F-type conjugal transfer pilus assembly protein TraB traB
HV042_RS29780 (HV042_29790) 66637..67071 + 435 WP_020322358 conjugal transfer protein TraP -
HV042_RS29785 (HV042_29795) 67105..67689 + 585 WP_064343530 type IV conjugative transfer system lipoprotein TraV traV
HV042_RS29790 (HV042_29800) 68302..68490 + 189 WP_053390286 hypothetical protein -
HV042_RS31315 68574..68975 + 402 WP_064343532 hypothetical protein -
HV042_RS29800 (HV042_29810) 68972..69271 + 300 WP_053390308 hypothetical protein -
HV042_RS29805 (HV042_29815) 69359..69742 + 384 WP_042946290 hypothetical protein -
HV042_RS29810 (HV042_29820) 69835..72474 + 2640 WP_064343533 type IV secretion system protein TraC virb4
HV042_RS29815 (HV042_29825) 72474..72866 + 393 WP_064343534 type-F conjugative transfer system protein TrbI -
HV042_RS29820 (HV042_29830) 72863..73489 + 627 WP_064343535 type-F conjugative transfer system protein TraW traW
HV042_RS29825 (HV042_29835) 73533..74492 + 960 WP_229295972 conjugal transfer pilus assembly protein TraU traU
HV042_RS29830 (HV042_29840) 74505..75152 + 648 WP_064343536 type-F conjugative transfer system pilin assembly protein TrbC trbC
HV042_RS29835 (HV042_29845) 75149..75532 + 384 WP_053390297 hypothetical protein -
HV042_RS29840 (HV042_29850) 75529..77484 + 1956 WP_080848160 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HV042_RS29845 (HV042_29855) 77516..77776 + 261 WP_053390216 hypothetical protein -
HV042_RS29850 (HV042_29860) 77769..78380 + 612 WP_053390217 hypothetical protein -
HV042_RS29855 (HV042_29865) 78370..78612 + 243 WP_053390218 conjugal transfer protein TrbE -
HV042_RS29860 (HV042_29870) 78658..78984 + 327 WP_053390219 hypothetical protein -
HV042_RS29865 (HV042_29875) 79005..79757 + 753 WP_064386181 type-F conjugative transfer system pilin assembly protein TraF traF
HV042_RS29870 (HV042_29880) 80171..80530 - 360 WP_064386183 hypothetical protein -
HV042_RS29875 (HV042_29885) 80596..81564 + 969 WP_074181092 IS5 family transposase -
HV042_RS29880 (HV042_29890) 81685..81921 + 237 WP_064386186 type-F conjugative transfer system pilin chaperone TraQ -
HV042_RS29885 (HV042_29895) 81896..82462 + 567 WP_100663597 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HV042_RS29890 (HV042_29900) 82455..82883 + 429 WP_100663598 conjugal transfer protein TrbF -
HV042_RS29895 (HV042_29905) 82870..84240 + 1371 WP_064386191 conjugal transfer pilus assembly protein TraH traH
HV042_RS29900 (HV042_29910) 84240..87119 + 2880 WP_064386194 conjugal transfer mating-pair stabilization protein TraG traG
HV042_RS29905 (HV042_29915) 87136..87804 + 669 WP_128317877 hypothetical protein -
HV042_RS29910 (HV042_29920) 88157..88888 + 732 WP_064386198 conjugal transfer complement resistance protein TraT -
HV042_RS31320 89080..89772 + 693 WP_202395549 hypothetical protein -
HV042_RS29920 (HV042_29930) 89891..92209 + 2319 WP_064386203 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   5624 GenBank   NZ_CP058182
Plasmid name   pRHBSTW-00039_3 Incompatibility group   Col440I
Plasmid size   103340 bp Coordinate of oriT [Strand]   61188..61236 [-]
Host baterium   Klebsiella grimontii strain RHBSTW-00039

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -