Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 73992..74262 | Replicon | plasmid unnamed3 |
| Accession | NZ_CP027576 | ||
| Organism | Escherichia coli strain 2013C-4081 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | A2F94_RS30440 | Protein ID | WP_001312861.1 |
| Coordinates | 74104..74262 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 73992..74055 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A2F94_RS30400 | 69217..69441 | - | 225 | WP_106905013.1 | hypothetical protein | - |
| A2F94_RS30415 | 69786..70313 | + | 528 | WP_000290792.1 | single-stranded DNA-binding protein | - |
| A2F94_RS30420 | 70369..70602 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| A2F94_RS30425 | 70661..72619 | + | 1959 | WP_001145472.1 | ParB/RepB/Spo0J family partition protein | - |
| A2F94_RS30430 | 72674..73108 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| A2F94_RS30435 | 73105..73824 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| A2F94_RS30955 | 73836..74024 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 73836..74060 | + | 225 | NuclAT_0 | - | - |
| - | 73836..74060 | + | 225 | NuclAT_0 | - | - |
| - | 73836..74060 | + | 225 | NuclAT_0 | - | - |
| - | 73836..74060 | + | 225 | NuclAT_0 | - | - |
| - | 73992..74055 | - | 64 | - | - | Antitoxin |
| A2F94_RS30440 | 74104..74262 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| A2F94_RS31170 | 74616..74840 | - | 225 | WP_001427866.1 | hypothetical protein | - |
| A2F94_RS30460 | 75184..75471 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| A2F94_RS30465 | 75592..76413 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| A2F94_RS30470 | 76710..77219 | - | 510 | Protein_83 | transglycosylase SLT domain-containing protein | - |
| A2F94_RS30475 | 77633..78016 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyC / hlyA / hlyB / hlyD / espP | 1..78427 | 78427 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T99499 WP_001312861.1 NZ_CP027576:74104-74262 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T99499 NZ_CP027576:74104-74262 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT99499 NZ_CP027576:c74055-73992 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|