Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 34901..35171 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP027554 | ||
| Organism | Escherichia coli strain 2013C-3513 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | C6991_RS00310 | Protein ID | WP_001312861.1 |
| Coordinates | 35013..35171 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 34901..34964 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C6991_RS00265 | 29962..30222 | + | 261 | WP_071600428.1 | hypothetical protein | - |
| C6991_RS00280 | 30695..31222 | + | 528 | WP_000290816.1 | single-stranded DNA-binding protein | - |
| C6991_RS00285 | 31278..31511 | + | 234 | WP_058653442.1 | DUF905 domain-containing protein | - |
| C6991_RS00290 | 31570..33528 | + | 1959 | WP_058653444.1 | ParB/RepB/Spo0J family partition protein | - |
| C6991_RS00295 | 33583..34017 | + | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| C6991_RS00300 | 34014..34733 | + | 720 | WP_033807739.1 | plasmid SOS inhibition protein A | - |
| - | 34745..34969 | + | 225 | NuclAT_0 | - | - |
| - | 34745..34969 | + | 225 | NuclAT_0 | - | - |
| - | 34745..34969 | + | 225 | NuclAT_0 | - | - |
| - | 34745..34969 | + | 225 | NuclAT_0 | - | - |
| - | 34901..34964 | - | 64 | - | - | Antitoxin |
| C6991_RS00310 | 35013..35171 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| C6991_RS31460 | 35409..35786 | - | 378 | Protein_53 | hypothetical protein | - |
| C6991_RS00325 | 36086..36382 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| C6991_RS00330 | 36493..37314 | + | 822 | WP_021503380.1 | DUF945 domain-containing protein | - |
| C6991_RS00335 | 37610..38257 | - | 648 | WP_072208664.1 | transglycosylase SLT domain-containing protein | - |
| C6991_RS00340 | 38543..38926 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
| C6991_RS00345 | 39120..39806 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| C6991_RS00350 | 39901..40128 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / tet(B) | - | 1..70129 | 70129 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T99425 WP_001312861.1 NZ_CP027554:35013-35171 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T99425 NZ_CP027554:35013-35171 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT99425 NZ_CP027554:c34964-34901 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|