Detailed information of TA system TA098780

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-agrB/Ldr(toxin)
• Location: 200946..201167
• Replicon: chromosome
• Accession: NZ_CP027440
• Organism: Escherichia coli strain 2012C-4502

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A4T9GRH2
• Locus tag: C6W69_RS01280
• Protein ID: WP_001563152.1
• Coordinates: 200946..201053 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	agrB
Locus tag	-
Coordinates	201101..201167 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
C6W69_RS01255	196790..197872	+	1083	WP_000804726.1	peptide chain release factor 1	-
C6W69_RS01260	197872..198705	+	834	WP_000456473.1	peptide chain release factor N(5)-glutamine methyltransferase	-
C6W69_RS01265	198702..199094	+	393	WP_000200374.1	invasion regulator SirB2	-
C6W69_RS01270	199098..199907	+	810	WP_001257044.1	invasion regulator SirB1	-
C6W69_RS01275	199943..200797	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
C6W69_RS01280	200946..201053	-	108	WP_001563152.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	201101..201167	+	67	NuclAT_13	-	Antitoxin
-	201101..201167	+	67	NuclAT_13	-	Antitoxin
-	201101..201167	+	67	NuclAT_13	-	Antitoxin
-	201101..201167	+	67	NuclAT_13	-	Antitoxin
-	201101..201167	+	67	NuclAT_14	-	Antitoxin
-	201101..201167	+	67	NuclAT_14	-	Antitoxin
-	201101..201167	+	67	NuclAT_14	-	Antitoxin
-	201101..201167	+	67	NuclAT_14	-	Antitoxin
-	201101..201167	+	67	NuclAT_15	-	Antitoxin
-	201101..201167	+	67	NuclAT_15	-	Antitoxin
-	201101..201167	+	67	NuclAT_15	-	Antitoxin
-	201101..201167	+	67	NuclAT_15	-	Antitoxin
-	201101..201167	+	67	NuclAT_16	-	Antitoxin
-	201101..201167	+	67	NuclAT_16	-	Antitoxin
-	201101..201167	+	67	NuclAT_16	-	Antitoxin
-	201101..201167	+	67	NuclAT_16	-	Antitoxin
-	201101..201167	+	67	NuclAT_17	-	Antitoxin
-	201101..201167	+	67	NuclAT_17	-	Antitoxin
-	201101..201167	+	67	NuclAT_17	-	Antitoxin
-	201101..201167	+	67	NuclAT_17	-	Antitoxin
-	201101..201167	+	67	NuclAT_18	-	Antitoxin
-	201101..201167	+	67	NuclAT_18	-	Antitoxin
-	201101..201167	+	67	NuclAT_18	-	Antitoxin
-	201101..201167	+	67	NuclAT_18	-	Antitoxin
-	201103..201166	+	64	NuclAT_19	-	-
-	201103..201166	+	64	NuclAT_19	-	-
-	201103..201166	+	64	NuclAT_19	-	-
-	201103..201166	+	64	NuclAT_19	-	-
-	201103..201166	+	64	NuclAT_20	-	-
-	201103..201166	+	64	NuclAT_20	-	-
-	201103..201166	+	64	NuclAT_20	-	-
-	201103..201166	+	64	NuclAT_20	-	-
-	201103..201166	+	64	NuclAT_21	-	-
-	201103..201166	+	64	NuclAT_21	-	-
-	201103..201166	+	64	NuclAT_21	-	-
-	201103..201166	+	64	NuclAT_21	-	-
-	201103..201166	+	64	NuclAT_22	-	-
-	201103..201166	+	64	NuclAT_22	-	-
-	201103..201166	+	64	NuclAT_22	-	-
-	201103..201166	+	64	NuclAT_22	-	-
-	201103..201166	+	64	NuclAT_23	-	-
-	201103..201166	+	64	NuclAT_23	-	-
-	201103..201166	+	64	NuclAT_23	-	-
-	201103..201166	+	64	NuclAT_23	-	-
-	201103..201166	+	64	NuclAT_24	-	-
-	201103..201166	+	64	NuclAT_24	-	-
-	201103..201166	+	64	NuclAT_24	-	-
-	201103..201166	+	64	NuclAT_24	-	-
-	201103..201168	+	66	NuclAT_28	-	-
-	201103..201168	+	66	NuclAT_28	-	-
-	201103..201168	+	66	NuclAT_28	-	-
-	201103..201168	+	66	NuclAT_28	-	-
-	201103..201168	+	66	NuclAT_29	-	-
-	201103..201168	+	66	NuclAT_29	-	-
-	201103..201168	+	66	NuclAT_29	-	-
-	201103..201168	+	66	NuclAT_29	-	-
C6W69_RS01285	201458..202558	-	1101	WP_000063608.1	sodium-potassium/proton antiporter ChaA	-
C6W69_RS01290	202828..203058	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
C6W69_RS01295	203216..203911	+	696	WP_001317784.1	glutathione-specific gamma-glutamylcyclotransferase	-
C6W69_RS01300	203955..204308	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
C6W69_RS01305	204494..205888	+	1395	WP_024196292.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3981.76 Da
• Isoelectric Point: 11.4779

>T98780 WP_001563152.1 NZ_CP027440:c201053-200946 [Escherichia coli]
MTLAQFTVIFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T98780 NZ_CP027440:c201053-200946 [Escherichia coli]
ATGACGCTCGCGCAGTTTACCGTGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT98780 NZ_CP027440:201101-201167 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A4T9GRH2

Antitoxin