Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3728133..3728353 | Replicon | chromosome |
| Accession | NZ_CP027027 | ||
| Organism | Shigella dysenteriae strain E670/74 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | C5S64_RS20355 | Protein ID | WP_000170955.1 |
| Coordinates | 3728246..3728353 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3728133..3728199 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C5S64_RS20330 | 3723411..3724805 | - | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
| C5S64_RS20335 | 3724991..3725344 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| C5S64_RS20340 | 3725388..3726083 | - | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| C5S64_RS20345 | 3726241..3726471 | - | 231 | WP_105241993.1 | putative cation transport regulator ChaB | - |
| C5S64_RS20350 | 3726741..3727841 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 3728133..3728199 | - | 67 | - | - | Antitoxin |
| C5S64_RS20355 | 3728246..3728353 | + | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | Toxin |
| C5S64_RS20360 | 3728502..3729356 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| C5S64_RS20365 | 3729392..3730201 | - | 810 | WP_001257048.1 | invasion regulator SirB1 | - |
| C5S64_RS20370 | 3730205..3730597 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| C5S64_RS20375 | 3730594..3731427 | - | 834 | WP_000386244.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| C5S64_RS20380 | 3731427..3732509 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T97034 WP_000170955.1 NZ_CP027027:3728246-3728353 [Shigella dysenteriae]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T97034 NZ_CP027027:3728246-3728353 [Shigella dysenteriae]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT97034 NZ_CP027027:c3728199-3728133 [Shigella dysenteriae]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|