Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2066625..2066807 | Replicon | chromosome |
| Accession | NZ_CP026961 | ||
| Organism | Staphylococcus aureus strain FDAARGOS_10 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | RK68_RS15310 | Protein ID | WP_001801861.1 |
| Coordinates | 2066712..2066807 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2066625..2066684 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RK68_RS11205 | 2065763..2066140 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| RK68_RS11210 | 2066334..2066510 | + | 177 | Protein_2065 | transposase | - |
| RK68_RS11215 | 2066488..2066589 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 2066625..2066684 | + | 60 | - | - | Antitoxin |
| RK68_RS15310 | 2066712..2066807 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| RK68_RS11225 | 2067010..2067153 | + | 144 | WP_001549059.1 | transposase | - |
| RK68_RS11235 | 2067757..2068140 | + | 384 | WP_000070812.1 | hypothetical protein | - |
| RK68_RS11240 | 2068151..2068327 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| RK68_RS11245 | 2068329..2068514 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| RK68_RS11250 | 2068628..2069269 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| RK68_RS11255 | 2069487..2070038 | - | 552 | WP_000414205.1 | hypothetical protein | - |
| RK68_RS11260 | 2070136..2070480 | - | 345 | WP_000627551.1 | DUF3969 family protein | - |
| RK68_RS11265 | 2070521..2071147 | - | 627 | WP_000669046.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | hlgA / lukD | 2033536..2104248 | 70712 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T96860 WP_001801861.1 NZ_CP026961:c2066807-2066712 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T96860 NZ_CP026961:c2066807-2066712 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT96860 NZ_CP026961:2066625-2066684 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|