Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 179358..179542 | Replicon | chromosome |
Accession | NZ_CP026067 | ||
Organism | Staphylococcus aureus strain FDAARGOS_21 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | RK79_RS00970 | Protein ID | WP_000482647.1 |
Coordinates | 179435..179542 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 179358..179418 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
RK79_RS00945 | 174812..174979 | - | 168 | WP_031927726.1 | hypothetical protein | - |
RK79_RS00955 | 175210..176943 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
RK79_RS00960 | 176968..178731 | - | 1764 | WP_031927727.1 | ABC transporter ATP-binding protein/permease | - |
- | 179358..179418 | + | 61 | - | - | Antitoxin |
RK79_RS00970 | 179435..179542 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
RK79_RS00975 | 179676..180062 | - | 387 | WP_000779353.1 | flippase GtxA | - |
RK79_RS00980 | 180330..181472 | + | 1143 | WP_001176870.1 | glycerate kinase | - |
RK79_RS00985 | 181532..182191 | + | 660 | WP_047212947.1 | membrane protein | - |
RK79_RS00990 | 182373..183584 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
RK79_RS00995 | 183707..184180 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T93033 WP_000482647.1 NZ_CP026067:c179542-179435 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T93033 NZ_CP026067:c179542-179435 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT93033 NZ_CP026067:179358-179418 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|