Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 32757..33026 | Replicon | plasmid pCTXM55_020023 |
Accession | NZ_CP025949 | ||
Organism | Escherichia coli strain SCEC020023 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | C1A20_RS01220 | Protein ID | WP_001312861.1 |
Coordinates | 32868..33026 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 32757..32822 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
C1A20_RS01195 | 28467..28994 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
C1A20_RS01200 | 29052..29285 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
C1A20_RS01205 | 29346..31369 | + | 2024 | Protein_39 | ParB/RepB/Spo0J family partition protein | - |
C1A20_RS01210 | 31438..31872 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
C1A20_RS01215 | 31869..32588 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 32600..32824 | + | 225 | NuclAT_0 | - | - |
- | 32600..32824 | + | 225 | NuclAT_0 | - | - |
- | 32600..32824 | + | 225 | NuclAT_0 | - | - |
- | 32600..32824 | + | 225 | NuclAT_0 | - | - |
C1A20_RS25235 | 32609..32788 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 32757..32822 | + | 66 | - | - | Antitoxin |
C1A20_RS01220 | 32868..33026 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
C1A20_RS25430 | 33264..33641 | - | 378 | Protein_44 | hypothetical protein | - |
C1A20_RS01240 | 33941..34237 | + | 297 | WP_001272251.1 | hypothetical protein | - |
C1A20_RS01245 | 34348..35169 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
C1A20_RS01250 | 35466..36113 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
C1A20_RS01255 | 36390..36773 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
C1A20_RS01260 | 36964..37650 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
C1A20_RS01265 | 37744..37971 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-IIa / blaTEM-1B / rmtB / blaCTX-M-55 | - | 1..73313 | 73313 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T92529 WP_001312861.1 NZ_CP025949:32868-33026 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T92529 NZ_CP025949:32868-33026 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT92529 NZ_CP025949:32757-32822 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|