Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2553403..2553625 | Replicon | chromosome |
| Accession | NZ_CP025520 | ||
| Organism | Escherichia coli strain DH5alpha | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | CDN75_RS13390 | Protein ID | WP_000141634.1 |
| Coordinates | 2553403..2553510 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2553559..2553625 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CDN75_RS13365 | 2548656..2549408 | - | 753 | Protein_2448 | cellulose biosynthesis protein BcsQ | - |
| CDN75_RS13370 | 2549420..2549608 | - | 189 | WP_001063318.1 | YhjR family protein | - |
| CDN75_RS13375 | 2549881..2551452 | + | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| CDN75_RS13380 | 2551449..2551640 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| CDN75_RS13385 | 2551637..2553316 | + | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| CDN75_RS13390 | 2553403..2553510 | - | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| - | 2553559..2553625 | + | 67 | - | - | Antitoxin |
| CDN75_RS13405 | 2553986..2555257 | + | 1272 | WP_001295225.1 | transporter | - |
| CDN75_RS13410 | 2555287..2556291 | - | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| CDN75_RS13415 | 2556288..2557271 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| CDN75_RS13420 | 2557282..2558184 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T90496 WP_000141634.1 NZ_CP025520:c2553510-2553403 [Escherichia coli]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T90496 NZ_CP025520:c2553510-2553403 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT90496 NZ_CP025520:2553559-2553625 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|