Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3999688..3999910 | Replicon | chromosome |
| Accession | NZ_CP025401 | ||
| Organism | Escherichia coli strain MS8345 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A0D6GD35 |
| Locus tag | MS8345_RS20950 | Protein ID | WP_000170745.1 |
| Coordinates | 3999688..3999795 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3999852..3999910 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS8345_RS20915 | 3994741..3994929 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| MS8345_RS20920 | 3995202..3996773 | + | 1572 | WP_001204957.1 | cellulose biosynthesis protein BcsE | - |
| MS8345_RS20925 | 3996770..3996961 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| MS8345_RS20930 | 3996958..3998637 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| MS8345_RS20935 | 3998723..3998830 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MS8345_RS29865 | 3999206..3999313 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| MS8345_RS20950 | 3999688..3999795 | - | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 3999852..3999910 | + | 59 | - | - | Antitoxin |
| MS8345_RS20965 | 4000271..4001542 | + | 1272 | WP_001332306.1 | amino acid permease | - |
| MS8345_RS20970 | 4001572..4002576 | - | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| MS8345_RS20975 | 4002573..4003556 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| MS8345_RS20980 | 4003567..4004469 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3855.68 Da Isoelectric Point: 9.0157
>T90295 WP_000170745.1 NZ_CP025401:c3999795-3999688 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVSWLNKRK
Download Length: 108 bp
>T90295 NZ_CP025401:c3999795-3999688 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAGCTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT90295 NZ_CP025401:3999852-3999910 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|