Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 542023..542244 Replicon chromosome
Accession NZ_CP024886
Organism Escherichia coli strain AR_0017

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AM344_RS02940 Protein ID WP_000170963.1
Coordinates 542023..542130 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 542178..542244 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AM344_RS02915 537867..538949 + 1083 WP_000804726.1 peptide chain release factor 1 -
AM344_RS02920 538949..539782 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
AM344_RS02925 539779..540171 + 393 WP_000200375.1 invasion regulator SirB2 -
AM344_RS02930 540175..540984 + 810 WP_001257054.1 invasion regulator SirB1 -
AM344_RS02935 541020..541874 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AM344_RS02940 542023..542130 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 542178..542244 + 67 NuclAT_10 - Antitoxin
- 542178..542244 + 67 NuclAT_10 - Antitoxin
- 542178..542244 + 67 NuclAT_10 - Antitoxin
- 542178..542244 + 67 NuclAT_10 - Antitoxin
- 542178..542244 + 67 NuclAT_11 - Antitoxin
- 542178..542244 + 67 NuclAT_11 - Antitoxin
- 542178..542244 + 67 NuclAT_11 - Antitoxin
- 542178..542244 + 67 NuclAT_11 - Antitoxin
- 542178..542244 + 67 NuclAT_6 - Antitoxin
- 542178..542244 + 67 NuclAT_6 - Antitoxin
- 542178..542244 + 67 NuclAT_6 - Antitoxin
- 542178..542244 + 67 NuclAT_6 - Antitoxin
- 542178..542244 + 67 NuclAT_7 - Antitoxin
- 542178..542244 + 67 NuclAT_7 - Antitoxin
- 542178..542244 + 67 NuclAT_7 - Antitoxin
- 542178..542244 + 67 NuclAT_7 - Antitoxin
- 542178..542244 + 67 NuclAT_8 - Antitoxin
- 542178..542244 + 67 NuclAT_8 - Antitoxin
- 542178..542244 + 67 NuclAT_8 - Antitoxin
- 542178..542244 + 67 NuclAT_8 - Antitoxin
- 542178..542244 + 67 NuclAT_9 - Antitoxin
- 542178..542244 + 67 NuclAT_9 - Antitoxin
- 542178..542244 + 67 NuclAT_9 - Antitoxin
- 542178..542244 + 67 NuclAT_9 - Antitoxin
- 542180..542243 + 64 NuclAT_12 - -
- 542180..542243 + 64 NuclAT_12 - -
- 542180..542243 + 64 NuclAT_12 - -
- 542180..542243 + 64 NuclAT_12 - -
- 542180..542243 + 64 NuclAT_13 - -
- 542180..542243 + 64 NuclAT_13 - -
- 542180..542243 + 64 NuclAT_13 - -
- 542180..542243 + 64 NuclAT_13 - -
- 542180..542243 + 64 NuclAT_14 - -
- 542180..542243 + 64 NuclAT_14 - -
- 542180..542243 + 64 NuclAT_14 - -
- 542180..542243 + 64 NuclAT_14 - -
- 542180..542243 + 64 NuclAT_15 - -
- 542180..542243 + 64 NuclAT_15 - -
- 542180..542243 + 64 NuclAT_15 - -
- 542180..542243 + 64 NuclAT_15 - -
- 542180..542243 + 64 NuclAT_16 - -
- 542180..542243 + 64 NuclAT_16 - -
- 542180..542243 + 64 NuclAT_16 - -
- 542180..542243 + 64 NuclAT_16 - -
- 542180..542243 + 64 NuclAT_17 - -
- 542180..542243 + 64 NuclAT_17 - -
- 542180..542243 + 64 NuclAT_17 - -
- 542180..542243 + 64 NuclAT_17 - -
- 542180..542245 + 66 NuclAT_19 - -
- 542180..542245 + 66 NuclAT_19 - -
- 542180..542245 + 66 NuclAT_19 - -
- 542180..542245 + 66 NuclAT_19 - -
- 542180..542245 + 66 NuclAT_20 - -
- 542180..542245 + 66 NuclAT_20 - -
- 542180..542245 + 66 NuclAT_20 - -
- 542180..542245 + 66 NuclAT_20 - -
- 542180..542245 + 66 NuclAT_21 - -
- 542180..542245 + 66 NuclAT_21 - -
- 542180..542245 + 66 NuclAT_21 - -
- 542180..542245 + 66 NuclAT_21 - -
- 542180..542245 + 66 NuclAT_22 - -
- 542180..542245 + 66 NuclAT_22 - -
- 542180..542245 + 66 NuclAT_22 - -
- 542180..542245 + 66 NuclAT_22 - -
- 542180..542245 + 66 NuclAT_24 - -
- 542180..542245 + 66 NuclAT_24 - -
- 542180..542245 + 66 NuclAT_24 - -
- 542180..542245 + 66 NuclAT_24 - -
- 542180..542245 + 66 NuclAT_25 - -
- 542180..542245 + 66 NuclAT_25 - -
- 542180..542245 + 66 NuclAT_25 - -
- 542180..542245 + 66 NuclAT_25 - -
AM344_RS02950 542535..543635 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
AM344_RS02955 543905..544135 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AM344_RS02960 544293..544988 + 696 WP_024187950.1 glutathione-specific gamma-glutamylcyclotransferase -
AM344_RS02965 545032..545385 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AM344_RS02970 545570..546964 + 1395 WP_000086188.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T89094 WP_000170963.1 NZ_CP024886:c542130-542023 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T89094 NZ_CP024886:c542130-542023 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT89094 NZ_CP024886:542178-542244 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References