Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1389649..1389870 | Replicon | chromosome |
| Accession | NZ_CP023826 | ||
| Organism | Escherichia coli strain 4/4 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A1U9U3P9 |
| Locus tag | CRT43_RS07005 | Protein ID | WP_001531632.1 |
| Coordinates | 1389649..1389756 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1389804..1389870 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CRT43_RS06980 | 1385493..1386575 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| CRT43_RS06985 | 1386575..1387408 | + | 834 | WP_000456450.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CRT43_RS06990 | 1387405..1387797 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
| CRT43_RS06995 | 1387801..1388610 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| CRT43_RS07000 | 1388646..1389500 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CRT43_RS07005 | 1389649..1389756 | - | 108 | WP_001531632.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1389804..1389870 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_10 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_5 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_5 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_5 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_5 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_6 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_6 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_6 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_6 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_7 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_8 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 1389804..1389870 | + | 67 | NuclAT_9 | - | Antitoxin |
| - | 1389806..1389869 | + | 64 | NuclAT_12 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_12 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_12 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_12 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_13 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_13 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_13 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_13 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_14 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_14 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_14 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_14 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_15 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_15 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_15 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_15 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_16 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_16 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_16 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_16 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_17 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_17 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_17 | - | - |
| - | 1389806..1389869 | + | 64 | NuclAT_17 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_18 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_18 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_18 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_18 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_19 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_19 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_19 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_19 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_20 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_20 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_20 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_20 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_21 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_21 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_21 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_21 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_22 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_22 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_22 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_22 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_23 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_23 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_23 | - | - |
| - | 1389806..1389871 | + | 66 | NuclAT_23 | - | - |
| CRT43_RS07010 | 1390161..1391261 | - | 1101 | WP_000063608.1 | sodium-potassium/proton antiporter ChaA | - |
| CRT43_RS07015 | 1391531..1391770 | + | 240 | WP_000120702.1 | putative cation transport regulator ChaB | - |
| CRT43_RS07020 | 1391919..1392614 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CRT43_RS07025 | 1392658..1393011 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| CRT43_RS07030 | 1393196..1394590 | + | 1395 | WP_000086187.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4040.89 Da Isoelectric Point: 12.5163
>T86105 WP_001531632.1 NZ_CP023826:c1389756-1389649 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK
Download Length: 108 bp
>T86105 NZ_CP023826:c1389756-1389649 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT86105 NZ_CP023826:1389804-1389870 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|