Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 16553..16822 | Replicon | plasmid p109 |
| Accession | NZ_CP023372 | ||
| Organism | Escherichia coli strain 1283 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | CNQ51_RS24215 | Protein ID | WP_001312861.1 |
| Coordinates | 16664..16822 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 16553..16618 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CNQ51_RS24165 | 12669..13234 | + | 566 | Protein_17 | class I SAM-dependent methyltransferase | - |
| CNQ51_RS24170 | 13260..13472 | + | 213 | WP_001348622.1 | hypothetical protein | - |
| CNQ51_RS26225 | 13882..14088 | + | 207 | WP_000275856.1 | hypothetical protein | - |
| CNQ51_RS24190 | 14114..14653 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| CNQ51_RS24195 | 14721..14954 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| CNQ51_RS24200 | 14982..15179 | + | 198 | Protein_22 | hypothetical protein | - |
| CNQ51_RS24205 | 15234..15668 | + | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| CNQ51_RS24210 | 15665..16384 | + | 720 | WP_001276238.1 | plasmid SOS inhibition protein A | - |
| CNQ51_RS26115 | 16396..16584 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 16396..16620 | + | 225 | NuclAT_0 | - | - |
| - | 16396..16620 | + | 225 | NuclAT_0 | - | - |
| - | 16396..16620 | + | 225 | NuclAT_0 | - | - |
| - | 16396..16620 | + | 225 | NuclAT_0 | - | - |
| - | 16553..16618 | + | 66 | - | - | Antitoxin |
| CNQ51_RS24215 | 16664..16822 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| CNQ51_RS24225 | 17743..18030 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| CNQ51_RS24230 | 18148..18969 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| CNQ51_RS24235 | 19266..19868 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| CNQ51_RS24240 | 20189..20572 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| CNQ51_RS24245 | 20759..21448 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / sitABCD | - | 1..109207 | 109207 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T81016 WP_001312861.1 NZ_CP023372:16664-16822 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T81016 NZ_CP023372:16664-16822 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT81016 NZ_CP023372:16553-16618 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|