Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2163621..2163842 Replicon chromosome
Accession NZ_CP022154
Organism Escherichia coli strain ABWA45

Toxin (Protein)


Gene name ldrD Uniprot ID E3PKK3
Locus tag CES94_RS11305 Protein ID WP_000170951.1
Coordinates 2163621..2163728 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2163776..2163842 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CES94_RS11280 2159467..2160549 + 1083 WP_000804726.1 peptide chain release factor 1 -
CES94_RS11285 2160549..2161382 + 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -
CES94_RS11290 2161379..2161771 + 393 WP_000200386.1 invasion regulator SirB2 -
CES94_RS11295 2161775..2162584 + 810 WP_088765703.1 invasion regulator SirB1 -
CES94_RS11300 2162620..2163474 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CES94_RS11305 2163621..2163728 - 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2163776..2163842 + 67 NuclAT_13 - Antitoxin
- 2163776..2163842 + 67 NuclAT_13 - Antitoxin
- 2163776..2163842 + 67 NuclAT_13 - Antitoxin
- 2163776..2163842 + 67 NuclAT_13 - Antitoxin
- 2163776..2163842 + 67 NuclAT_15 - Antitoxin
- 2163776..2163842 + 67 NuclAT_15 - Antitoxin
- 2163776..2163842 + 67 NuclAT_15 - Antitoxin
- 2163776..2163842 + 67 NuclAT_15 - Antitoxin
- 2163776..2163842 + 67 NuclAT_17 - Antitoxin
- 2163776..2163842 + 67 NuclAT_17 - Antitoxin
- 2163776..2163842 + 67 NuclAT_17 - Antitoxin
- 2163776..2163842 + 67 NuclAT_17 - Antitoxin
- 2163776..2163842 + 67 NuclAT_19 - Antitoxin
- 2163776..2163842 + 67 NuclAT_19 - Antitoxin
- 2163776..2163842 + 67 NuclAT_19 - Antitoxin
- 2163776..2163842 + 67 NuclAT_19 - Antitoxin
- 2163776..2163842 + 67 NuclAT_21 - Antitoxin
- 2163776..2163842 + 67 NuclAT_21 - Antitoxin
- 2163776..2163842 + 67 NuclAT_21 - Antitoxin
- 2163776..2163842 + 67 NuclAT_21 - Antitoxin
- 2163776..2163842 + 67 NuclAT_23 - Antitoxin
- 2163776..2163842 + 67 NuclAT_23 - Antitoxin
- 2163776..2163842 + 67 NuclAT_23 - Antitoxin
- 2163776..2163842 + 67 NuclAT_23 - Antitoxin
- 2163778..2163841 + 64 NuclAT_26 - -
- 2163778..2163841 + 64 NuclAT_26 - -
- 2163778..2163841 + 64 NuclAT_26 - -
- 2163778..2163841 + 64 NuclAT_26 - -
- 2163778..2163841 + 64 NuclAT_28 - -
- 2163778..2163841 + 64 NuclAT_28 - -
- 2163778..2163841 + 64 NuclAT_28 - -
- 2163778..2163841 + 64 NuclAT_28 - -
- 2163778..2163841 + 64 NuclAT_30 - -
- 2163778..2163841 + 64 NuclAT_30 - -
- 2163778..2163841 + 64 NuclAT_30 - -
- 2163778..2163841 + 64 NuclAT_30 - -
- 2163778..2163841 + 64 NuclAT_32 - -
- 2163778..2163841 + 64 NuclAT_32 - -
- 2163778..2163841 + 64 NuclAT_32 - -
- 2163778..2163841 + 64 NuclAT_32 - -
- 2163778..2163841 + 64 NuclAT_34 - -
- 2163778..2163841 + 64 NuclAT_34 - -
- 2163778..2163841 + 64 NuclAT_34 - -
- 2163778..2163841 + 64 NuclAT_34 - -
- 2163778..2163841 + 64 NuclAT_36 - -
- 2163778..2163841 + 64 NuclAT_36 - -
- 2163778..2163841 + 64 NuclAT_36 - -
- 2163778..2163841 + 64 NuclAT_36 - -
- 2163778..2163843 + 66 NuclAT_38 - -
- 2163778..2163843 + 66 NuclAT_38 - -
- 2163778..2163843 + 66 NuclAT_38 - -
- 2163778..2163843 + 66 NuclAT_38 - -
- 2163778..2163843 + 66 NuclAT_40 - -
- 2163778..2163843 + 66 NuclAT_40 - -
- 2163778..2163843 + 66 NuclAT_40 - -
- 2163778..2163843 + 66 NuclAT_40 - -
- 2163778..2163843 + 66 NuclAT_42 - -
- 2163778..2163843 + 66 NuclAT_42 - -
- 2163778..2163843 + 66 NuclAT_42 - -
- 2163778..2163843 + 66 NuclAT_42 - -
CES94_RS11315 2164156..2164263 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2164311..2164376 + 66 NuclAT_25 - -
- 2164311..2164376 + 66 NuclAT_25 - -
- 2164311..2164376 + 66 NuclAT_25 - -
- 2164311..2164376 + 66 NuclAT_25 - -
- 2164311..2164376 + 66 NuclAT_27 - -
- 2164311..2164376 + 66 NuclAT_27 - -
- 2164311..2164376 + 66 NuclAT_27 - -
- 2164311..2164376 + 66 NuclAT_27 - -
- 2164311..2164376 + 66 NuclAT_29 - -
- 2164311..2164376 + 66 NuclAT_29 - -
- 2164311..2164376 + 66 NuclAT_29 - -
- 2164311..2164376 + 66 NuclAT_29 - -
- 2164311..2164376 + 66 NuclAT_31 - -
- 2164311..2164376 + 66 NuclAT_31 - -
- 2164311..2164376 + 66 NuclAT_31 - -
- 2164311..2164376 + 66 NuclAT_31 - -
- 2164311..2164376 + 66 NuclAT_33 - -
- 2164311..2164376 + 66 NuclAT_33 - -
- 2164311..2164376 + 66 NuclAT_33 - -
- 2164311..2164376 + 66 NuclAT_33 - -
- 2164311..2164376 + 66 NuclAT_35 - -
- 2164311..2164376 + 66 NuclAT_35 - -
- 2164311..2164376 + 66 NuclAT_35 - -
- 2164311..2164376 + 66 NuclAT_35 - -
- 2164311..2164378 + 68 NuclAT_37 - -
- 2164311..2164378 + 68 NuclAT_37 - -
- 2164311..2164378 + 68 NuclAT_37 - -
- 2164311..2164378 + 68 NuclAT_37 - -
- 2164311..2164378 + 68 NuclAT_39 - -
- 2164311..2164378 + 68 NuclAT_39 - -
- 2164311..2164378 + 68 NuclAT_39 - -
- 2164311..2164378 + 68 NuclAT_39 - -
- 2164311..2164378 + 68 NuclAT_41 - -
- 2164311..2164378 + 68 NuclAT_41 - -
- 2164311..2164378 + 68 NuclAT_41 - -
- 2164311..2164378 + 68 NuclAT_41 - -
- 2164312..2164377 + 66 NuclAT_14 - -
- 2164312..2164377 + 66 NuclAT_14 - -
- 2164312..2164377 + 66 NuclAT_14 - -
- 2164312..2164377 + 66 NuclAT_14 - -
- 2164312..2164377 + 66 NuclAT_16 - -
- 2164312..2164377 + 66 NuclAT_16 - -
- 2164312..2164377 + 66 NuclAT_16 - -
- 2164312..2164377 + 66 NuclAT_16 - -
- 2164312..2164377 + 66 NuclAT_18 - -
- 2164312..2164377 + 66 NuclAT_18 - -
- 2164312..2164377 + 66 NuclAT_18 - -
- 2164312..2164377 + 66 NuclAT_18 - -
- 2164312..2164377 + 66 NuclAT_20 - -
- 2164312..2164377 + 66 NuclAT_20 - -
- 2164312..2164377 + 66 NuclAT_20 - -
- 2164312..2164377 + 66 NuclAT_20 - -
- 2164312..2164377 + 66 NuclAT_22 - -
- 2164312..2164377 + 66 NuclAT_22 - -
- 2164312..2164377 + 66 NuclAT_22 - -
- 2164312..2164377 + 66 NuclAT_22 - -
- 2164312..2164377 + 66 NuclAT_24 - -
- 2164312..2164377 + 66 NuclAT_24 - -
- 2164312..2164377 + 66 NuclAT_24 - -
- 2164312..2164377 + 66 NuclAT_24 - -
CES94_RS11325 2164668..2165768 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CES94_RS11330 2166038..2166268 + 231 WP_001146444.1 putative cation transport regulator ChaB -
CES94_RS11335 2166426..2167121 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CES94_RS11340 2167165..2167518 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3961.74 Da        Isoelectric Point: 9.1413

>T78567 WP_000170951.1 NZ_CP022154:c2163728-2163621 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T78567 NZ_CP022154:c2163728-2163621 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT78567 NZ_CP022154:2163776-2163842 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB E3PKK3

Antitoxin

Download structure file

References