Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 2163621..2163842 | Replicon | chromosome |
| Accession | NZ_CP022154 | ||
| Organism | Escherichia coli strain ABWA45 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E3PKK3 |
| Locus tag | CES94_RS11305 | Protein ID | WP_000170951.1 |
| Coordinates | 2163621..2163728 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2163776..2163842 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CES94_RS11280 | 2159467..2160549 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| CES94_RS11285 | 2160549..2161382 | + | 834 | WP_000456454.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CES94_RS11290 | 2161379..2161771 | + | 393 | WP_000200386.1 | invasion regulator SirB2 | - |
| CES94_RS11295 | 2161775..2162584 | + | 810 | WP_088765703.1 | invasion regulator SirB1 | - |
| CES94_RS11300 | 2162620..2163474 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CES94_RS11305 | 2163621..2163728 | - | 108 | WP_000170951.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2163776..2163842 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_13 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_15 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_17 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_19 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_21 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 2163776..2163842 | + | 67 | NuclAT_23 | - | Antitoxin |
| - | 2163778..2163841 | + | 64 | NuclAT_26 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_26 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_26 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_26 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_28 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_28 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_28 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_28 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_30 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_30 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_30 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_30 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_32 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_32 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_32 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_32 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_34 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_34 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_34 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_34 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_36 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_36 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_36 | - | - |
| - | 2163778..2163841 | + | 64 | NuclAT_36 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_38 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_38 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_38 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_38 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_40 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_40 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_40 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_40 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_42 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_42 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_42 | - | - |
| - | 2163778..2163843 | + | 66 | NuclAT_42 | - | - |
| CES94_RS11315 | 2164156..2164263 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | - |
| - | 2164311..2164376 | + | 66 | NuclAT_25 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_25 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_25 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_25 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_27 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_27 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_27 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_27 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_29 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_29 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_29 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_29 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_31 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_31 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_31 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_31 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_33 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_33 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_33 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_33 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_35 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_35 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_35 | - | - |
| - | 2164311..2164376 | + | 66 | NuclAT_35 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_37 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_37 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_37 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_37 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_39 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_39 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_39 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_39 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_41 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_41 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_41 | - | - |
| - | 2164311..2164378 | + | 68 | NuclAT_41 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_14 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_14 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_14 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_14 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_16 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_16 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_16 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_16 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_18 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_18 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_18 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_18 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_20 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_20 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_20 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_20 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_22 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_22 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_22 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_22 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_24 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_24 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_24 | - | - |
| - | 2164312..2164377 | + | 66 | NuclAT_24 | - | - |
| CES94_RS11325 | 2164668..2165768 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| CES94_RS11330 | 2166038..2166268 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| CES94_RS11335 | 2166426..2167121 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CES94_RS11340 | 2167165..2167518 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3961.74 Da Isoelectric Point: 9.1413
>T78567 WP_000170951.1 NZ_CP022154:c2163728-2163621 [Escherichia coli]
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWDDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T78567 NZ_CP022154:c2163728-2163621 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT78567 NZ_CP022154:2163776-2163842 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|