Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1707502..1707772 | Replicon | chromosome |
| Accession | NZ_CP021535 | ||
| Organism | Escherichia coli strain AR_0119 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | AM366_RS08905 | Protein ID | WP_001312861.1 |
| Coordinates | 1707614..1707772 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 1707502..1707565 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AM366_RS08875 | 1703213..1703740 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| AM366_RS08880 | 1703798..1704031 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| AM366_RS08885 | 1704092..1706115 | + | 2024 | Protein_1596 | ParB/RepB/Spo0J family partition protein | - |
| AM366_RS08890 | 1706184..1706618 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| AM366_RS08895 | 1706615..1707334 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 1707346..1707570 | + | 225 | NuclAT_0 | - | - |
| - | 1707346..1707570 | + | 225 | NuclAT_0 | - | - |
| - | 1707346..1707570 | + | 225 | NuclAT_0 | - | - |
| - | 1707346..1707570 | + | 225 | NuclAT_0 | - | - |
| AM366_RS08900 | 1707355..1707534 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 1707502..1707565 | - | 64 | - | - | Antitoxin |
| AM366_RS08905 | 1707614..1707772 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| AM366_RS08910 | 1708130..1708555 | + | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| AM366_RS08915 | 1708552..1708902 | + | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| AM366_RS08920 | 1708933..1710546 | + | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| AM366_RS29640 | 1710631..1710835 | - | 205 | Protein_1604 | pilus protein | - |
| AM366_RS08940 | 1711227..1711523 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| AM366_RS08945 | 1711634..1712455 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaCTX-M-15 | algU | 1641851..1827083 | 185232 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T76767 WP_001312861.1 NZ_CP021535:1707614-1707772 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T76767 NZ_CP021535:1707614-1707772 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT76767 NZ_CP021535:c1707565-1707502 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|