Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 1934759..1935058 | Replicon | chromosome |
| Accession | NZ_CP021178 | ||
| Organism | Staphylococcus aureus subsp. aureus ST398 strain 2012-3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | CAC37_RS09380 | Protein ID | WP_011447039.1 |
| Coordinates | 1934882..1935058 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 1934759..1934814 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CAC37_RS09340 | 1930090..1930350 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| CAC37_RS09345 | 1930403..1930753 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| CAC37_RS09350 | 1931438..1931887 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| CAC37_RS09355 | 1931982..1932317 | - | 336 | Protein_1804 | SH3 domain-containing protein | - |
| CAC37_RS09360 | 1932967..1933458 | - | 492 | WP_000919350.1 | staphylokinase | - |
| CAC37_RS09365 | 1933649..1934404 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| CAC37_RS09370 | 1934416..1934670 | - | 255 | WP_000611512.1 | phage holin | - |
| CAC37_RS09375 | 1934722..1934829 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 1934751..1934890 | + | 140 | NuclAT_0 | - | - |
| - | 1934751..1934890 | + | 140 | NuclAT_0 | - | - |
| - | 1934751..1934890 | + | 140 | NuclAT_0 | - | - |
| - | 1934751..1934890 | + | 140 | NuclAT_0 | - | - |
| - | 1934759..1934814 | + | 56 | - | - | Antitoxin |
| CAC37_RS09380 | 1934882..1935058 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| CAC37_RS09385 | 1935208..1935504 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| CAC37_RS09390 | 1935562..1935849 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| CAC37_RS09395 | 1935896..1936048 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| CAC37_RS09400 | 1936038..1939823 | - | 3786 | WP_096777926.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 1930403..1986251 | 55848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T76181 WP_011447039.1 NZ_CP021178:c1935058-1934882 [Staphylococcus aureus subsp. aureus ST398]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T76181 NZ_CP021178:c1935058-1934882 [Staphylococcus aureus subsp. aureus ST398]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT76181 NZ_CP021178:1934759-1934814 [Staphylococcus aureus subsp. aureus ST398]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|