Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2428769..2428953 | Replicon | chromosome |
Accession | NZ_CP021105 | ||
Organism | Staphylococcus aureus strain CC5 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | B4893_RS12660 | Protein ID | WP_000482652.1 |
Coordinates | 2428846..2428953 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2428769..2428829 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
B4893_RS12635 | 2424224..2424391 | - | 168 | Protein_2324 | hypothetical protein | - |
B4893_RS12645 | 2424622..2426355 | - | 1734 | WP_107383448.1 | ABC transporter ATP-binding protein/permease | - |
B4893_RS12650 | 2426380..2428143 | - | 1764 | WP_001064825.1 | ABC transporter ATP-binding protein/permease | - |
- | 2428769..2428829 | + | 61 | - | - | Antitoxin |
B4893_RS12660 | 2428846..2428953 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
B4893_RS12665 | 2429087..2429473 | - | 387 | WP_000779360.1 | flippase GtxA | - |
B4893_RS12670 | 2429741..2430883 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
B4893_RS12675 | 2430943..2431602 | + | 660 | WP_000831298.1 | membrane protein | - |
B4893_RS12680 | 2431784..2432995 | + | 1212 | WP_094659772.1 | multidrug effflux MFS transporter | - |
B4893_RS12685 | 2433118..2433591 | - | 474 | WP_000456486.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T75982 WP_000482652.1 NZ_CP021105:c2428953-2428846 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T75982 NZ_CP021105:c2428953-2428846 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT75982 NZ_CP021105:2428769-2428829 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|