Detailed information of TA system TA073817

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4422598..4422817
• Replicon: chromosome
• Accession: NZ_CP020025
• Organism: Escherichia coli strain WB61

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A829L523
• Locus tag: B1T56_RS22460
• Protein ID: WP_000170738.1
• Coordinates: 4422598..4422705 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4422754..4422817 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
B1T56_RS22435	4417854..4418606	-	753	WP_000279524.1	cellulose biosynthesis protein BcsQ	-
B1T56_RS22440	4418618..4418806	-	189	WP_001063314.1	YhjR family protein	-
B1T56_RS22445	4419078..4420649	+	1572	WP_001204946.1	cellulose biosynthesis protein BcsE	-
B1T56_RS22450	4420646..4420837	+	192	WP_000988308.1	cellulose biosynthesis protein BcsF	-
B1T56_RS22455	4420834..4422582	+	1749	Protein_4145	cellulose biosynthesis protein BcsG	-
B1T56_RS22460	4422598..4422705	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4422754..4422817	+	64	NuclAT_13	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_13	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_13	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_13	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_15	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_15	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_15	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_15	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_17	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_17	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_17	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_17	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_20	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_20	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_20	-	Antitoxin
-	4422754..4422817	+	64	NuclAT_20	-	Antitoxin
-	4422754..4422819	+	66	NuclAT_10	-	-
-	4422754..4422819	+	66	NuclAT_10	-	-
-	4422754..4422819	+	66	NuclAT_10	-	-
-	4422754..4422819	+	66	NuclAT_10	-	-
-	4422754..4422819	+	66	NuclAT_11	-	-
-	4422754..4422819	+	66	NuclAT_11	-	-
-	4422754..4422819	+	66	NuclAT_11	-	-
-	4422754..4422819	+	66	NuclAT_11	-	-
B1T56_RS22470	4423180..4424451	+	1272	WP_022646242.1	amino acid permease	-
B1T56_RS22475	4424481..4425485	-	1005	WP_000107033.1	dipeptide ABC transporter ATP-binding subunit DppF	-
B1T56_RS22480	4425482..4426465	-	984	WP_001196481.1	dipeptide ABC transporter ATP-binding protein	-
B1T56_RS22485	4426476..4427378	-	903	WP_000084677.1	dipeptide ABC transporter permease DppC	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3864.67 Da
• Isoelectric Point: 9.0157

>T73817 WP_000170738.1 NZ_CP020025:c4422705-4422598 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Nucleotide

• Length: 108 bp

>T73817 NZ_CP020025:c4422705-4422598 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTCTGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT73817 NZ_CP020025:4422754-4422817 [Escherichia coli]
GTCTAGATTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A829L523

Antitoxin