Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3894082..3894304 | Replicon | chromosome |
| Accession | NZ_CP019273 | ||
| Organism | Escherichia coli strain 13P477T | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | BWI89_RS29345 | Protein ID | WP_001295224.1 |
| Coordinates | 3894197..3894304 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3894082..3894148 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI89_RS20135 | 3889470..3890453 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| BWI89_RS20140 | 3890450..3891454 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BWI89_RS20145 | 3891484..3892755 | - | 1272 | WP_001318103.1 | amino acid permease | - |
| BWI89_RS29340 | 3893231..3893338 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| BWI89_RS20165 | 3893714..3893821 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 3894082..3894148 | - | 67 | - | - | Antitoxin |
| BWI89_RS29345 | 3894197..3894304 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| BWI89_RS29350 | 3894680..3894787 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| BWI89_RS20185 | 3894874..3896553 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| BWI89_RS20190 | 3896550..3896741 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BWI89_RS20195 | 3896738..3898309 | - | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
| BWI89_RS20200 | 3898582..3898770 | + | 189 | WP_001063315.1 | YhjR family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T72163 WP_001295224.1 NZ_CP019273:3894197-3894304 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T72163 NZ_CP019273:3894197-3894304 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT72163 NZ_CP019273:c3894148-3894082 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|