Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 86869..87139 | Replicon | plasmid p13P460A-1 |
| Accession | NZ_CP019272 | ||
| Organism | Escherichia coli strain 13P460A | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BWI88_RS25085 | Protein ID | WP_001312861.1 |
| Coordinates | 86981..87139 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 86869..86932 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI88_RS25060 | 82580..83107 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| BWI88_RS25065 | 83165..83398 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| BWI88_RS25070 | 83459..85482 | + | 2024 | Protein_101 | ParB/RepB/Spo0J family partition protein | - |
| BWI88_RS25075 | 85551..85985 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| BWI88_RS25080 | 85982..86701 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| - | 86713..86937 | + | 225 | NuclAT_0 | - | - |
| - | 86713..86937 | + | 225 | NuclAT_0 | - | - |
| - | 86713..86937 | + | 225 | NuclAT_0 | - | - |
| - | 86713..86937 | + | 225 | NuclAT_0 | - | - |
| BWI88_RS26670 | 86722..86901 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - | 86869..86932 | - | 64 | - | - | Antitoxin |
| BWI88_RS25085 | 86981..87139 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BWI88_RS26845 | 87377..87754 | - | 378 | Protein_106 | hypothetical protein | - |
| BWI88_RS25105 | 88054..88350 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| BWI88_RS25110 | 88461..89282 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| BWI88_RS25115 | 89579..90226 | - | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
| BWI88_RS25120 | 90503..90886 | + | 384 | WP_000124981.1 | relaxosome protein TraM | - |
| BWI88_RS25125 | 91077..91763 | + | 687 | WP_015059009.1 | PAS domain-containing protein | - |
| BWI88_RS25130 | 91857..92084 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / oqxA / oqxB / aph(3')-IIa / fosA3 / blaTEM-1B / blaCTX-M-55 | - | 1..129452 | 129452 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T72135 WP_001312861.1 NZ_CP019272:86981-87139 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T72135 NZ_CP019272:86981-87139 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT72135 NZ_CP019272:c86932-86869 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|