Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 33518..33782 | Replicon | plasmid pCombat13F7-3 |
| Accession | NZ_CP019248 | ||
| Organism | Escherichia coli strain Combat13F7 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | BWI83_RS25795 | Protein ID | WP_001331364.1 |
| Coordinates | 33518..33670 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 33720..33782 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI83_RS25775 | 28786..30954 | + | 2169 | WP_000698354.1 | DotA/TraY family protein | - |
| BWI83_RS25780 | 31025..31687 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| BWI83_RS25785 | 31759..31968 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| BWI83_RS26990 | 32360..32536 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| BWI83_RS25790 | 33195..33446 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| BWI83_RS25795 | 33518..33670 | - | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| - | 33720..33782 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 33720..33782 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 33720..33782 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 33720..33782 | + | 63 | NuclAT_0 | - | Antitoxin |
| BWI83_RS25800 | 33962..35170 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| BWI83_RS25805 | 35189..36259 | + | 1071 | WP_000151582.1 | IncI1-type conjugal transfer protein TrbB | - |
| BWI83_RS25810 | 36252..38543 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aph(3'')-Ib / aph(6)-Id | - | 1..121975 | 121975 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T71965 WP_001331364.1 NZ_CP019248:c33670-33518 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T71965 NZ_CP019248:c33670-33518 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT71965 NZ_CP019248:33720-33782 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|