Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2796174..2796396 | Replicon | chromosome |
| Accession | NZ_CP019243 | ||
| Organism | Escherichia coli strain Combat2C1 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | BWI82_RS14430 | Protein ID | WP_001295224.1 |
| Coordinates | 2796174..2796281 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2796330..2796396 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWI82_RS14405 | 2791427..2792179 | - | 753 | Protein_2643 | cellulose biosynthesis protein BcsQ | - |
| BWI82_RS14410 | 2792191..2792379 | - | 189 | WP_001063314.1 | YhjR family protein | - |
| BWI82_RS14415 | 2792652..2794223 | + | 1572 | WP_001204945.1 | cellulose biosynthesis protein BcsE | - |
| BWI82_RS14420 | 2794220..2794411 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| BWI82_RS14425 | 2794408..2796087 | + | 1680 | WP_000191565.1 | cellulose biosynthesis protein BcsG | - |
| BWI82_RS14430 | 2796174..2796281 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2796330..2796396 | + | 67 | - | - | Antitoxin |
| BWI82_RS14445 | 2796757..2798028 | + | 1272 | WP_001298005.1 | amino acid permease | - |
| BWI82_RS14450 | 2798058..2799062 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| BWI82_RS14455 | 2799059..2800042 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
| BWI82_RS14460 | 2800053..2800955 | - | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T71920 WP_001295224.1 NZ_CP019243:c2796281-2796174 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T71920 NZ_CP019243:c2796281-2796174 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT71920 NZ_CP019243:2796330-2796396 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGGTTCAAGATTAGCCCCCGTGATATTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|