Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3729768..3729989 Replicon chromosome
Accession NZ_CP018840
Organism Escherichia coli strain KSC64

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag BUQ71_RS19015 Protein ID WP_000170926.1
Coordinates 3729768..3729875 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3729928..3729989 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BUQ71_RS18985 3725847..3726680 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
BUQ71_RS18990 3726677..3727069 + 393 WP_000200374.1 invasion regulator SirB2 -
BUQ71_RS18995 3727073..3727882 + 810 WP_001257044.1 invasion regulator SirB1 -
BUQ71_RS19000 3727918..3728772 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
BUQ71_RS19005 3728921..3729028 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3729076..3729142 + 67 NuclAT_38 - -
- 3729076..3729142 + 67 NuclAT_38 - -
- 3729076..3729142 + 67 NuclAT_38 - -
- 3729076..3729142 + 67 NuclAT_38 - -
- 3729076..3729142 + 67 NuclAT_40 - -
- 3729076..3729142 + 67 NuclAT_40 - -
- 3729076..3729142 + 67 NuclAT_40 - -
- 3729076..3729142 + 67 NuclAT_40 - -
- 3729076..3729142 + 67 NuclAT_42 - -
- 3729076..3729142 + 67 NuclAT_42 - -
- 3729076..3729142 + 67 NuclAT_42 - -
- 3729076..3729142 + 67 NuclAT_42 - -
- 3729078..3729141 + 64 NuclAT_22 - -
- 3729078..3729141 + 64 NuclAT_22 - -
- 3729078..3729141 + 64 NuclAT_22 - -
- 3729078..3729141 + 64 NuclAT_22 - -
- 3729078..3729141 + 64 NuclAT_25 - -
- 3729078..3729141 + 64 NuclAT_25 - -
- 3729078..3729141 + 64 NuclAT_25 - -
- 3729078..3729141 + 64 NuclAT_25 - -
- 3729078..3729141 + 64 NuclAT_28 - -
- 3729078..3729141 + 64 NuclAT_28 - -
- 3729078..3729141 + 64 NuclAT_28 - -
- 3729078..3729141 + 64 NuclAT_28 - -
- 3729078..3729141 + 64 NuclAT_31 - -
- 3729078..3729141 + 64 NuclAT_31 - -
- 3729078..3729141 + 64 NuclAT_31 - -
- 3729078..3729141 + 64 NuclAT_31 - -
- 3729078..3729141 + 64 NuclAT_34 - -
- 3729078..3729141 + 64 NuclAT_34 - -
- 3729078..3729141 + 64 NuclAT_34 - -
- 3729078..3729141 + 64 NuclAT_34 - -
- 3729078..3729141 + 64 NuclAT_37 - -
- 3729078..3729141 + 64 NuclAT_37 - -
- 3729078..3729141 + 64 NuclAT_37 - -
- 3729078..3729141 + 64 NuclAT_37 - -
BUQ71_RS19015 3729768..3729875 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3729928..3729989 + 62 NuclAT_21 - Antitoxin
- 3729928..3729989 + 62 NuclAT_21 - Antitoxin
- 3729928..3729989 + 62 NuclAT_21 - Antitoxin
- 3729928..3729989 + 62 NuclAT_21 - Antitoxin
- 3729928..3729989 + 62 NuclAT_24 - Antitoxin
- 3729928..3729989 + 62 NuclAT_24 - Antitoxin
- 3729928..3729989 + 62 NuclAT_24 - Antitoxin
- 3729928..3729989 + 62 NuclAT_24 - Antitoxin
- 3729928..3729989 + 62 NuclAT_27 - Antitoxin
- 3729928..3729989 + 62 NuclAT_27 - Antitoxin
- 3729928..3729989 + 62 NuclAT_27 - Antitoxin
- 3729928..3729989 + 62 NuclAT_27 - Antitoxin
- 3729928..3729989 + 62 NuclAT_30 - Antitoxin
- 3729928..3729989 + 62 NuclAT_30 - Antitoxin
- 3729928..3729989 + 62 NuclAT_30 - Antitoxin
- 3729928..3729989 + 62 NuclAT_30 - Antitoxin
- 3729928..3729989 + 62 NuclAT_33 - Antitoxin
- 3729928..3729989 + 62 NuclAT_33 - Antitoxin
- 3729928..3729989 + 62 NuclAT_33 - Antitoxin
- 3729928..3729989 + 62 NuclAT_33 - Antitoxin
- 3729928..3729989 + 62 NuclAT_36 - Antitoxin
- 3729928..3729989 + 62 NuclAT_36 - Antitoxin
- 3729928..3729989 + 62 NuclAT_36 - Antitoxin
- 3729928..3729989 + 62 NuclAT_36 - Antitoxin
- 3729928..3729990 + 63 NuclAT_39 - -
- 3729928..3729990 + 63 NuclAT_39 - -
- 3729928..3729990 + 63 NuclAT_39 - -
- 3729928..3729990 + 63 NuclAT_39 - -
- 3729928..3729990 + 63 NuclAT_41 - -
- 3729928..3729990 + 63 NuclAT_41 - -
- 3729928..3729990 + 63 NuclAT_41 - -
- 3729928..3729990 + 63 NuclAT_41 - -
- 3729928..3729990 + 63 NuclAT_43 - -
- 3729928..3729990 + 63 NuclAT_43 - -
- 3729928..3729990 + 63 NuclAT_43 - -
- 3729928..3729990 + 63 NuclAT_43 - -
BUQ71_RS19020 3730304..3730411 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3730459..3730524 + 66 NuclAT_20 - -
- 3730459..3730524 + 66 NuclAT_20 - -
- 3730459..3730524 + 66 NuclAT_20 - -
- 3730459..3730524 + 66 NuclAT_20 - -
- 3730459..3730524 + 66 NuclAT_23 - -
- 3730459..3730524 + 66 NuclAT_23 - -
- 3730459..3730524 + 66 NuclAT_23 - -
- 3730459..3730524 + 66 NuclAT_23 - -
- 3730459..3730524 + 66 NuclAT_26 - -
- 3730459..3730524 + 66 NuclAT_26 - -
- 3730459..3730524 + 66 NuclAT_26 - -
- 3730459..3730524 + 66 NuclAT_26 - -
- 3730459..3730524 + 66 NuclAT_29 - -
- 3730459..3730524 + 66 NuclAT_29 - -
- 3730459..3730524 + 66 NuclAT_29 - -
- 3730459..3730524 + 66 NuclAT_29 - -
- 3730459..3730524 + 66 NuclAT_32 - -
- 3730459..3730524 + 66 NuclAT_32 - -
- 3730459..3730524 + 66 NuclAT_32 - -
- 3730459..3730524 + 66 NuclAT_32 - -
- 3730459..3730524 + 66 NuclAT_35 - -
- 3730459..3730524 + 66 NuclAT_35 - -
- 3730459..3730524 + 66 NuclAT_35 - -
- 3730459..3730524 + 66 NuclAT_35 - -
- 3730459..3730526 + 68 NuclAT_14 - -
- 3730459..3730526 + 68 NuclAT_14 - -
- 3730459..3730526 + 68 NuclAT_14 - -
- 3730459..3730526 + 68 NuclAT_14 - -
- 3730459..3730526 + 68 NuclAT_15 - -
- 3730459..3730526 + 68 NuclAT_15 - -
- 3730459..3730526 + 68 NuclAT_15 - -
- 3730459..3730526 + 68 NuclAT_15 - -
- 3730459..3730526 + 68 NuclAT_16 - -
- 3730459..3730526 + 68 NuclAT_16 - -
- 3730459..3730526 + 68 NuclAT_16 - -
- 3730459..3730526 + 68 NuclAT_16 - -
- 3730459..3730526 + 68 NuclAT_17 - -
- 3730459..3730526 + 68 NuclAT_17 - -
- 3730459..3730526 + 68 NuclAT_17 - -
- 3730459..3730526 + 68 NuclAT_17 - -
- 3730459..3730526 + 68 NuclAT_18 - -
- 3730459..3730526 + 68 NuclAT_18 - -
- 3730459..3730526 + 68 NuclAT_18 - -
- 3730459..3730526 + 68 NuclAT_18 - -
- 3730459..3730526 + 68 NuclAT_19 - -
- 3730459..3730526 + 68 NuclAT_19 - -
- 3730459..3730526 + 68 NuclAT_19 - -
- 3730459..3730526 + 68 NuclAT_19 - -
BUQ71_RS19030 3730816..3731916 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
BUQ71_RS19035 3732186..3732416 + 231 WP_087514642.1 putative cation transport regulator ChaB -
BUQ71_RS19040 3732574..3733269 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
BUQ71_RS19045 3733313..3733666 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T70674 WP_000170926.1 NZ_CP018840:c3729875-3729768 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T70674 NZ_CP018840:c3729875-3729768 [Escherichia coli]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT70674 NZ_CP018840:3729928-3729989 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGAGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References