Detailed information of TA system TA068219

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 106831..107085
• Replicon: plasmid pEcoFMU07332d
• Accession: NZ_CP017848
• Organism: Escherichia coli strain FMU073332

Toxin (Protein)

• Gene name: srnB
• Uniprot ID: -
• Locus tag: BLJ80_RS27765
• Protein ID: WP_032186826.1
• Coordinates: 106831..107037 (-)
• Length: 69 a.a.

Antitoxin (RNA)

Gene name	srnC
Locus tag	-
Coordinates	107029..107085 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
BLJ80_RS27710	102161..102379	+	219	Protein_126	IS91 family transposase	-
BLJ80_RS27715	102568..102669	-	102	Protein_127	methionyl-tRNA formyltransferase	-
BLJ80_RS27720	102684..103193	-	510	WP_000115001.1	peptide deformylase	-
BLJ80_RS27725	103570..103857	-	288	WP_000865086.1	helix-turn-helix transcriptional regulator	-
BLJ80_RS27730	103857..104168	-	312	WP_000483538.1	type II toxin-antitoxin system RelE/ParE family toxin	-
BLJ80_RS27745	105140..105997	-	858	WP_000130964.1	incFII family plasmid replication initiator RepA	-
BLJ80_RS27750	105990..106064	-	75	WP_001365571.1	RepA leader peptide Tap	-
BLJ80_RS27760	106287..106547	-	261	WP_000083817.1	replication regulatory protein RepA	-
BLJ80_RS27765	106831..107037	-	207	WP_032186826.1	type I toxin-antitoxin system Hok family toxin	Toxin
-	107029..107085	+	57	NuclAT_1	-	Antitoxin
-	107029..107085	+	57	NuclAT_1	-	Antitoxin
-	107029..107085	+	57	NuclAT_1	-	Antitoxin
-	107029..107085	+	57	NuclAT_1	-	Antitoxin
BLJ80_RS27775	107329..107511	+	183	WP_001705320.1	hypothetical protein	-
BLJ80_RS27780	107736..108149	-	414	WP_077625677.1	type-F conjugative transfer system pilin acetylase TraX	-
BLJ80_RS27785	108812..110263	-	1452	Protein_137	type IV conjugative transfer system coupling protein TraD	-
BLJ80_RS27790	110263..110514	-	252	Protein_138	conjugal transfer protein TraK	-
BLJ80_RS27795	110504..111067	-	564	WP_000406020.1	type IV conjugative transfer system protein TraE	-
BLJ80_RS27800	111087..111392	-	306	WP_000016323.1	type IV conjugative transfer system protein TraL	-
BLJ80_RS27805	111394..111753	-	360	WP_001054220.1	type IV conjugative transfer system pilin TraA	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	eltB / eltA / etpA / etpB / cs3	1..137665	137665
	-	flank	IS/Tn	-	-	102104..102379	275

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (23-64)

Sequences

Toxin

Protein

• Length: 69 a.a.
• Molecular weight: 7822.32 Da
• Isoelectric Point: 8.8807

>T68219 WP_032186826.1 NZ_CP017848:c107037-106831 [Escherichia coli]
MKYLNTTDCSLFLAERSKFMTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Nucleotide

• Length: 207 bp

>T68219 NZ_CP017848:c107037-106831 [Escherichia coli]
ATGAAGTACTTGAACACTACTGATTGTAGCCTCTTCCTTGCAGAGAGGTCAAAGTTTATGACGAAATATACCCTTATTGG
GTTGCTCGCCGTGTGTGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTTATGTGAACTGAATATTCACAGAG
GAAATACAGTGGTGCAGGTAACTTTGGCCTACGAAGCACGGAAGTAA

Antitoxin

Nucleotide

• Length: 57 bp

>AT68219 NZ_CP017848:107029-107085 [Escherichia coli]
GTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT

Structures

Antitoxin