Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 103985..104411 | Replicon | plasmid pSLK172-2 |
Accession | NZ_CP017633 | ||
Organism | Escherichia coli strain SLK172 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | BJJ90_RS31595 | Protein ID | WP_001312861.1 |
Coordinates | 103985..104143 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 104187..104411 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BJJ90_RS31550 | 99040..99267 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
BJJ90_RS31555 | 99361..100047 | - | 687 | WP_015059009.1 | PAS domain-containing protein | - |
BJJ90_RS31560 | 100238..100621 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
BJJ90_RS31565 | 100898..101545 | + | 648 | WP_015059008.1 | transglycosylase SLT domain-containing protein | - |
BJJ90_RS31570 | 101842..102663 | - | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
BJJ90_RS31575 | 102774..103070 | - | 297 | WP_001272251.1 | hypothetical protein | - |
BJJ90_RS33960 | 103370..103747 | + | 378 | Protein_122 | hypothetical protein | - |
BJJ90_RS31595 | 103985..104143 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 104187..104411 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 104187..104411 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 104187..104411 | - | 225 | NuclAT_0 | - | Antitoxin |
- | 104187..104411 | - | 225 | NuclAT_0 | - | Antitoxin |
BJJ90_RS33590 | 104223..104402 | + | 180 | WP_001309233.1 | hypothetical protein | - |
BJJ90_RS31605 | 104423..105142 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
BJJ90_RS31610 | 105139..105573 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
BJJ90_RS31615 | 105642..107665 | - | 2024 | Protein_127 | ParB/RepB/Spo0J family partition protein | - |
BJJ90_RS31620 | 107726..107959 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
BJJ90_RS31625 | 108017..108544 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
BJJ90_RS33965 | 108846..109295 | + | 450 | WP_045892832.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-55 / blaTEM-1B / fosA3 / oqxA / oqxB / aph(3')-IIa / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR | - | 1..120528 | 120528 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T67851 WP_001312861.1 NZ_CP017633:c104143-103985 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T67851 NZ_CP017633:c104143-103985 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 225 bp
>AT67851 NZ_CP017633:c104411-104187 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|