Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3134549..3134774 | Replicon | chromosome |
Accession | NZ_CP016625 | ||
Organism | Escherichia coli O157:H7 strain FRIK944 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | S1ELB5 |
Locus tag | A9L45_RS16630 | Protein ID | WP_000813254.1 |
Coordinates | 3134549..3134704 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 3134716..3134774 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
A9L45_RS16595 | 3129852..3130910 | - | 1059 | WP_000483497.1 | site-specific DNA-methyltransferase | - |
A9L45_RS16600 | 3131061..3131258 | - | 198 | WP_000917735.1 | hypothetical protein | - |
A9L45_RS16605 | 3131485..3132306 | - | 822 | WP_000762904.1 | antitermination protein | - |
A9L45_RS16610 | 3132303..3132677 | - | 375 | WP_000904137.1 | RusA family crossover junction endodeoxyribonuclease | - |
A9L45_RS31905 | 3132690..3133739 | - | 1050 | Protein_3187 | DUF968 domain-containing protein | - |
A9L45_RS31910 | 3133741..3134019 | - | 279 | WP_001304183.1 | hypothetical protein | - |
A9L45_RS35455 | 3134085..3134252 | - | 168 | WP_000998188.1 | hypothetical protein | - |
A9L45_RS16630 | 3134549..3134704 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
- | 3134716..3134774 | + | 59 | - | - | Antitoxin |
A9L45_RS33720 | 3134950..3135054 | - | 105 | WP_001278450.1 | hypothetical protein | - |
A9L45_RS16635 | 3135170..3135532 | - | 363 | WP_000610379.1 | DUF551 domain-containing protein | - |
A9L45_RS16640 | 3135529..3135900 | - | 372 | WP_000137941.1 | hypothetical protein | - |
A9L45_RS16645 | 3135936..3136148 | - | 213 | WP_000063625.1 | hypothetical protein | - |
A9L45_RS16650 | 3136197..3136553 | - | 357 | WP_001302146.1 | hypothetical protein | - |
A9L45_RS16655 | 3136610..3137005 | - | 396 | WP_001118161.1 | DUF977 family protein | - |
A9L45_RS16660 | 3137021..3137791 | - | 771 | WP_000450888.1 | DUF1627 domain-containing protein | - |
A9L45_RS16665 | 3137821..3138561 | - | 741 | WP_000790456.1 | ATP-binding protein | - |
A9L45_RS16670 | 3138568..3139521 | - | 954 | WP_000095667.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | espM1 / nleA/espI / stxB / stxA | 3100943..3211002 | 110059 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T64897 WP_000813254.1 NZ_CP016625:c3134704-3134549 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T64897 NZ_CP016625:c3134704-3134549 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGCTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT64897 NZ_CP016625:3134716-3134774 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACGTGTGTAGAGCATAGATATGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|