Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1800411..1800625 | Replicon | chromosome |
| Accession | NZ_CP016625 | ||
| Organism | Escherichia coli O157:H7 strain FRIK944 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | A9L45_RS09305 | Protein ID | WP_000170963.1 |
| Coordinates | 1800411..1800518 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1800566..1800625 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9L45_RS09275 | 1795720..1796802 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| A9L45_RS09280 | 1796802..1797635 | + | 834 | WP_000456466.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| A9L45_RS09285 | 1797632..1798024 | + | 393 | WP_000200379.1 | invasion regulator SirB2 | - |
| A9L45_RS09290 | 1798028..1798837 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| A9L45_RS09295 | 1798873..1799727 | + | 855 | WP_000811067.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| A9L45_RS09300 | 1799875..1799982 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1800035..1800096 | + | 62 | NuclAT_24 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_24 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_24 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_24 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_26 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_26 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_26 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_26 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_28 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_28 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_28 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_28 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_30 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_30 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_30 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_30 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_32 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_32 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_32 | - | - |
| - | 1800035..1800096 | + | 62 | NuclAT_32 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_17 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_17 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_17 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_17 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_18 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_18 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_18 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_18 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_19 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_19 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_19 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_19 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_20 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_20 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_20 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_20 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_22 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_22 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_22 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_22 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_23 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_23 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_23 | - | - |
| - | 1800035..1800097 | + | 63 | NuclAT_23 | - | - |
| A9L45_RS09305 | 1800411..1800518 | - | 108 | WP_000170963.1 | small toxic polypeptide LdrB | Toxin |
| - | 1800566..1800625 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_25 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_27 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_29 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_31 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_33 | - | Antitoxin |
| - | 1800566..1800625 | + | 60 | NuclAT_33 | - | Antitoxin |
| A9L45_RS09310 | 1800917..1802017 | - | 1101 | WP_001301956.1 | sodium-potassium/proton antiporter ChaA | - |
| A9L45_RS09315 | 1802287..1802517 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| A9L45_RS09320 | 1802678..1803373 | + | 696 | WP_001301489.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| A9L45_RS09325 | 1803417..1803770 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| A9L45_RS09330 | 1803956..1805350 | + | 1395 | WP_000086192.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T64881 WP_000170963.1 NZ_CP016625:c1800518-1800411 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T64881 NZ_CP016625:c1800518-1800411 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT64881 NZ_CP016625:1800566-1800625 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|