Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 99734..99973 | Replicon | plasmid pEC448_1 |
| Accession | NZ_CP015077 | ||
| Organism | Escherichia coli strain Ecol_448 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | A4R37_RS25540 | Protein ID | WP_023144756.1 |
| Coordinates | 99734..99868 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 99913..99973 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A4R37_RS25510 | 95400..97013 | - | 1614 | WP_000080200.1 | IS66-like element ISEc23 family transposase | - |
| A4R37_RS25515 | 97044..97394 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| A4R37_RS25520 | 97391..97816 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
| A4R37_RS25525 | 98022..98879 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| A4R37_RS25530 | 98872..98946 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| A4R37_RS29825 | 98943..99077 | - | 135 | Protein_126 | protein CopA/IncA | - |
| A4R37_RS25535 | 99183..99437 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| A4R37_RS25540 | 99734..99868 | - | 135 | WP_023144756.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 99913..99973 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 99913..99973 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 99913..99973 | + | 61 | NuclAT_2 | - | Antitoxin |
| - | 99913..99973 | + | 61 | NuclAT_2 | - | Antitoxin |
| A4R37_RS25545 | 99940..100226 | - | 287 | Protein_129 | DUF2726 domain-containing protein | - |
| A4R37_RS25550 | 100739..100951 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| A4R37_RS25555 | 101082..101642 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
| A4R37_RS25560 | 101697..102443 | - | 747 | WP_000205718.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD / blaTEM-1B / sul2 / aph(3'')-Ib / aph(6)-Id | - | 1..133735 | 133735 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T62272 WP_023144756.1 NZ_CP015077:c99868-99734 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T62272 NZ_CP015077:c99868-99734 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 61 bp
>AT62272 NZ_CP015077:99913-99973 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|