Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1385636..1385857 Replicon chromosome
Accession NZ_CP014316
Organism Escherichia coli JJ1887

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag AX202_RS07040 Protein ID WP_001531632.1
Coordinates 1385636..1385743 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1385791..1385857 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AX202_RS07015 1381480..1382562 + 1083 WP_000804726.1 peptide chain release factor 1 -
AX202_RS07020 1382562..1383395 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
AX202_RS07025 1383392..1383784 + 393 WP_000200375.1 invasion regulator SirB2 -
AX202_RS07030 1383788..1384597 + 810 WP_001257044.1 invasion regulator SirB1 -
AX202_RS07035 1384633..1385487 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AX202_RS07040 1385636..1385743 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1385791..1385857 + 67 NuclAT_10 - Antitoxin
- 1385791..1385857 + 67 NuclAT_10 - Antitoxin
- 1385791..1385857 + 67 NuclAT_10 - Antitoxin
- 1385791..1385857 + 67 NuclAT_10 - Antitoxin
- 1385791..1385857 + 67 NuclAT_5 - Antitoxin
- 1385791..1385857 + 67 NuclAT_5 - Antitoxin
- 1385791..1385857 + 67 NuclAT_5 - Antitoxin
- 1385791..1385857 + 67 NuclAT_5 - Antitoxin
- 1385791..1385857 + 67 NuclAT_6 - Antitoxin
- 1385791..1385857 + 67 NuclAT_6 - Antitoxin
- 1385791..1385857 + 67 NuclAT_6 - Antitoxin
- 1385791..1385857 + 67 NuclAT_6 - Antitoxin
- 1385791..1385857 + 67 NuclAT_7 - Antitoxin
- 1385791..1385857 + 67 NuclAT_7 - Antitoxin
- 1385791..1385857 + 67 NuclAT_7 - Antitoxin
- 1385791..1385857 + 67 NuclAT_7 - Antitoxin
- 1385791..1385857 + 67 NuclAT_8 - Antitoxin
- 1385791..1385857 + 67 NuclAT_8 - Antitoxin
- 1385791..1385857 + 67 NuclAT_8 - Antitoxin
- 1385791..1385857 + 67 NuclAT_8 - Antitoxin
- 1385791..1385857 + 67 NuclAT_9 - Antitoxin
- 1385791..1385857 + 67 NuclAT_9 - Antitoxin
- 1385791..1385857 + 67 NuclAT_9 - Antitoxin
- 1385791..1385857 + 67 NuclAT_9 - Antitoxin
- 1385793..1385856 + 64 NuclAT_12 - -
- 1385793..1385856 + 64 NuclAT_12 - -
- 1385793..1385856 + 64 NuclAT_12 - -
- 1385793..1385856 + 64 NuclAT_12 - -
- 1385793..1385856 + 64 NuclAT_13 - -
- 1385793..1385856 + 64 NuclAT_13 - -
- 1385793..1385856 + 64 NuclAT_13 - -
- 1385793..1385856 + 64 NuclAT_13 - -
- 1385793..1385856 + 64 NuclAT_14 - -
- 1385793..1385856 + 64 NuclAT_14 - -
- 1385793..1385856 + 64 NuclAT_14 - -
- 1385793..1385856 + 64 NuclAT_14 - -
- 1385793..1385856 + 64 NuclAT_15 - -
- 1385793..1385856 + 64 NuclAT_15 - -
- 1385793..1385856 + 64 NuclAT_15 - -
- 1385793..1385856 + 64 NuclAT_15 - -
- 1385793..1385856 + 64 NuclAT_16 - -
- 1385793..1385856 + 64 NuclAT_16 - -
- 1385793..1385856 + 64 NuclAT_16 - -
- 1385793..1385856 + 64 NuclAT_16 - -
- 1385793..1385856 + 64 NuclAT_17 - -
- 1385793..1385856 + 64 NuclAT_17 - -
- 1385793..1385856 + 64 NuclAT_17 - -
- 1385793..1385856 + 64 NuclAT_17 - -
- 1385793..1385858 + 66 NuclAT_18 - -
- 1385793..1385858 + 66 NuclAT_18 - -
- 1385793..1385858 + 66 NuclAT_18 - -
- 1385793..1385858 + 66 NuclAT_18 - -
- 1385793..1385858 + 66 NuclAT_19 - -
- 1385793..1385858 + 66 NuclAT_19 - -
- 1385793..1385858 + 66 NuclAT_19 - -
- 1385793..1385858 + 66 NuclAT_19 - -
- 1385793..1385858 + 66 NuclAT_20 - -
- 1385793..1385858 + 66 NuclAT_20 - -
- 1385793..1385858 + 66 NuclAT_20 - -
- 1385793..1385858 + 66 NuclAT_20 - -
- 1385793..1385858 + 66 NuclAT_21 - -
- 1385793..1385858 + 66 NuclAT_21 - -
- 1385793..1385858 + 66 NuclAT_21 - -
- 1385793..1385858 + 66 NuclAT_21 - -
- 1385793..1385858 + 66 NuclAT_22 - -
- 1385793..1385858 + 66 NuclAT_22 - -
- 1385793..1385858 + 66 NuclAT_22 - -
- 1385793..1385858 + 66 NuclAT_22 - -
- 1385793..1385858 + 66 NuclAT_23 - -
- 1385793..1385858 + 66 NuclAT_23 - -
- 1385793..1385858 + 66 NuclAT_23 - -
- 1385793..1385858 + 66 NuclAT_23 - -
AX202_RS07045 1386148..1387248 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
AX202_RS07050 1387518..1387757 + 240 WP_000120702.1 putative cation transport regulator ChaB -
AX202_RS07055 1387906..1388601 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
AX202_RS07060 1388645..1388998 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AX202_RS07065 1389183..1390577 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T60696 WP_001531632.1 NZ_CP014316:c1385743-1385636 [Escherichia coli JJ1887]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T60696 NZ_CP014316:c1385743-1385636 [Escherichia coli JJ1887]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT60696 NZ_CP014316:1385791-1385857 [Escherichia coli JJ1887]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References