Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 576171..576392 Replicon chromosome
Accession NZ_CP014111
Organism Escherichia coli strain FDAARGOS_144

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AL502_RS03890 Protein ID WP_000170963.1
Coordinates 576171..576278 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 576326..576392 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AL502_RS03865 572015..573097 + 1083 WP_000804726.1 peptide chain release factor 1 -
AL502_RS03870 573097..573930 + 834 WP_022296435.1 peptide chain release factor N(5)-glutamine methyltransferase -
AL502_RS03875 573927..574319 + 393 WP_000200375.1 invasion regulator SirB2 -
AL502_RS03880 574323..575132 + 810 WP_001257054.1 invasion regulator SirB1 -
AL502_RS03885 575168..576022 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AL502_RS03890 576171..576278 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 576326..576392 + 67 NuclAT_10 - Antitoxin
- 576326..576392 + 67 NuclAT_10 - Antitoxin
- 576326..576392 + 67 NuclAT_10 - Antitoxin
- 576326..576392 + 67 NuclAT_10 - Antitoxin
- 576326..576392 + 67 NuclAT_11 - Antitoxin
- 576326..576392 + 67 NuclAT_11 - Antitoxin
- 576326..576392 + 67 NuclAT_11 - Antitoxin
- 576326..576392 + 67 NuclAT_11 - Antitoxin
- 576326..576392 + 67 NuclAT_6 - Antitoxin
- 576326..576392 + 67 NuclAT_6 - Antitoxin
- 576326..576392 + 67 NuclAT_6 - Antitoxin
- 576326..576392 + 67 NuclAT_6 - Antitoxin
- 576326..576392 + 67 NuclAT_7 - Antitoxin
- 576326..576392 + 67 NuclAT_7 - Antitoxin
- 576326..576392 + 67 NuclAT_7 - Antitoxin
- 576326..576392 + 67 NuclAT_7 - Antitoxin
- 576326..576392 + 67 NuclAT_8 - Antitoxin
- 576326..576392 + 67 NuclAT_8 - Antitoxin
- 576326..576392 + 67 NuclAT_8 - Antitoxin
- 576326..576392 + 67 NuclAT_8 - Antitoxin
- 576326..576392 + 67 NuclAT_9 - Antitoxin
- 576326..576392 + 67 NuclAT_9 - Antitoxin
- 576326..576392 + 67 NuclAT_9 - Antitoxin
- 576326..576392 + 67 NuclAT_9 - Antitoxin
- 576328..576391 + 64 NuclAT_14 - -
- 576328..576391 + 64 NuclAT_14 - -
- 576328..576391 + 64 NuclAT_14 - -
- 576328..576391 + 64 NuclAT_14 - -
- 576328..576391 + 64 NuclAT_15 - -
- 576328..576391 + 64 NuclAT_15 - -
- 576328..576391 + 64 NuclAT_15 - -
- 576328..576391 + 64 NuclAT_15 - -
- 576328..576391 + 64 NuclAT_16 - -
- 576328..576391 + 64 NuclAT_16 - -
- 576328..576391 + 64 NuclAT_16 - -
- 576328..576391 + 64 NuclAT_16 - -
- 576328..576391 + 64 NuclAT_17 - -
- 576328..576391 + 64 NuclAT_17 - -
- 576328..576391 + 64 NuclAT_17 - -
- 576328..576391 + 64 NuclAT_17 - -
- 576328..576391 + 64 NuclAT_18 - -
- 576328..576391 + 64 NuclAT_18 - -
- 576328..576391 + 64 NuclAT_18 - -
- 576328..576391 + 64 NuclAT_18 - -
- 576328..576391 + 64 NuclAT_19 - -
- 576328..576391 + 64 NuclAT_19 - -
- 576328..576391 + 64 NuclAT_19 - -
- 576328..576391 + 64 NuclAT_19 - -
- 576328..576393 + 66 NuclAT_20 - -
- 576328..576393 + 66 NuclAT_20 - -
- 576328..576393 + 66 NuclAT_20 - -
- 576328..576393 + 66 NuclAT_20 - -
- 576328..576393 + 66 NuclAT_21 - -
- 576328..576393 + 66 NuclAT_21 - -
- 576328..576393 + 66 NuclAT_21 - -
- 576328..576393 + 66 NuclAT_21 - -
- 576328..576393 + 66 NuclAT_22 - -
- 576328..576393 + 66 NuclAT_22 - -
- 576328..576393 + 66 NuclAT_22 - -
- 576328..576393 + 66 NuclAT_22 - -
- 576328..576393 + 66 NuclAT_23 - -
- 576328..576393 + 66 NuclAT_23 - -
- 576328..576393 + 66 NuclAT_23 - -
- 576328..576393 + 66 NuclAT_23 - -
- 576328..576393 + 66 NuclAT_24 - -
- 576328..576393 + 66 NuclAT_24 - -
- 576328..576393 + 66 NuclAT_24 - -
- 576328..576393 + 66 NuclAT_24 - -
AL502_RS03895 576683..577783 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
AL502_RS03900 578053..578283 + 231 WP_001607244.1 putative cation transport regulator ChaB -
AL502_RS03905 578441..579136 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
AL502_RS03910 579180..579533 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AL502_RS03915 579718..581112 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T60144 WP_000170963.1 NZ_CP014111:c576278-576171 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T60144 NZ_CP014111:c576278-576171 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTTGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT60144 NZ_CP014111:576326-576392 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References