Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 1174442..1174667 | Replicon | chromosome |
Accession | NZ_CP012802 | ||
Organism | Escherichia coli O157:H7 strain WS4202 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | - |
Locus tag | AO055_RS05615 | Protein ID | WP_000813263.1 |
Coordinates | 1174512..1174667 (+) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 1174442..1174500 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AO055_RS05590 | 1169717..1170808 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
AO055_RS05595 | 1170815..1171561 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
AO055_RS05600 | 1171583..1172353 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
AO055_RS05605 | 1172369..1172782 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
AO055_RS05610 | 1173134..1173907 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
- | 1174442..1174500 | - | 59 | - | - | Antitoxin |
AO055_RS05615 | 1174512..1174667 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
AO055_RS30090 | 1174835..1175113 | + | 279 | WP_001341388.1 | hypothetical protein | - |
AO055_RS05625 | 1175115..1176164 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
AO055_RS05630 | 1176177..1176548 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
AO055_RS05635 | 1176538..1176909 | + | 372 | WP_000090264.1 | antitermination protein | - |
AO055_RS05640 | 1177061..1177879 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
AO055_RS05645 | 1178166..1178362 | + | 197 | Protein_1070 | TrmB family transcriptional regulator | - |
AO055_RS05650 | 1178500..1179213 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T57214 WP_000813263.1 NZ_CP012802:1174512-1174667 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T57214 NZ_CP012802:1174512-1174667 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT57214 NZ_CP012802:c1174500-1174442 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|