Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 1281994..1282215 Replicon chromosome
Accession NZ_CP012379
Organism Escherichia coli strain PAR

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag AKO63_RS06515 Protein ID WP_000170954.1
Coordinates 1281994..1282101 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 1282154..1282215 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AKO63_RS06490 1277839..1278921 + 1083 WP_094058166.1 peptide chain release factor 1 -
AKO63_RS06495 1278921..1279754 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
AKO63_RS06500 1279751..1280143 + 393 WP_000200375.1 invasion regulator SirB2 -
AKO63_RS06505 1280147..1280956 + 810 WP_001257054.1 invasion regulator SirB1 -
AKO63_RS06510 1280992..1281846 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
AKO63_RS06515 1281994..1282101 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1282154..1282215 + 62 NuclAT_11 - Antitoxin
- 1282154..1282215 + 62 NuclAT_11 - Antitoxin
- 1282154..1282215 + 62 NuclAT_11 - Antitoxin
- 1282154..1282215 + 62 NuclAT_11 - Antitoxin
- 1282154..1282215 + 62 NuclAT_12 - Antitoxin
- 1282154..1282215 + 62 NuclAT_12 - Antitoxin
- 1282154..1282215 + 62 NuclAT_12 - Antitoxin
- 1282154..1282215 + 62 NuclAT_12 - Antitoxin
- 1282154..1282215 + 62 NuclAT_13 - Antitoxin
- 1282154..1282215 + 62 NuclAT_13 - Antitoxin
- 1282154..1282215 + 62 NuclAT_13 - Antitoxin
- 1282154..1282215 + 62 NuclAT_13 - Antitoxin
- 1282154..1282215 + 62 NuclAT_14 - Antitoxin
- 1282154..1282215 + 62 NuclAT_14 - Antitoxin
- 1282154..1282215 + 62 NuclAT_14 - Antitoxin
- 1282154..1282215 + 62 NuclAT_14 - Antitoxin
- 1282154..1282215 + 62 NuclAT_15 - Antitoxin
- 1282154..1282215 + 62 NuclAT_15 - Antitoxin
- 1282154..1282215 + 62 NuclAT_15 - Antitoxin
- 1282154..1282215 + 62 NuclAT_15 - Antitoxin
- 1282154..1282215 + 62 NuclAT_16 - Antitoxin
- 1282154..1282215 + 62 NuclAT_16 - Antitoxin
- 1282154..1282215 + 62 NuclAT_16 - Antitoxin
- 1282154..1282215 + 62 NuclAT_16 - Antitoxin
- 1282154..1282216 + 63 NuclAT_10 - -
- 1282154..1282216 + 63 NuclAT_10 - -
- 1282154..1282216 + 63 NuclAT_10 - -
- 1282154..1282216 + 63 NuclAT_10 - -
- 1282154..1282216 + 63 NuclAT_5 - -
- 1282154..1282216 + 63 NuclAT_5 - -
- 1282154..1282216 + 63 NuclAT_5 - -
- 1282154..1282216 + 63 NuclAT_5 - -
- 1282154..1282216 + 63 NuclAT_6 - -
- 1282154..1282216 + 63 NuclAT_6 - -
- 1282154..1282216 + 63 NuclAT_6 - -
- 1282154..1282216 + 63 NuclAT_6 - -
- 1282154..1282216 + 63 NuclAT_7 - -
- 1282154..1282216 + 63 NuclAT_7 - -
- 1282154..1282216 + 63 NuclAT_7 - -
- 1282154..1282216 + 63 NuclAT_7 - -
- 1282154..1282216 + 63 NuclAT_8 - -
- 1282154..1282216 + 63 NuclAT_8 - -
- 1282154..1282216 + 63 NuclAT_8 - -
- 1282154..1282216 + 63 NuclAT_8 - -
- 1282154..1282216 + 63 NuclAT_9 - -
- 1282154..1282216 + 63 NuclAT_9 - -
- 1282154..1282216 + 63 NuclAT_9 - -
- 1282154..1282216 + 63 NuclAT_9 - -
- 1282154..1282217 + 64 NuclAT_17 - -
- 1282154..1282217 + 64 NuclAT_17 - -
- 1282154..1282217 + 64 NuclAT_17 - -
- 1282154..1282217 + 64 NuclAT_17 - -
- 1282154..1282217 + 64 NuclAT_18 - -
- 1282154..1282217 + 64 NuclAT_18 - -
- 1282154..1282217 + 64 NuclAT_18 - -
- 1282154..1282217 + 64 NuclAT_18 - -
- 1282154..1282217 + 64 NuclAT_19 - -
- 1282154..1282217 + 64 NuclAT_19 - -
- 1282154..1282217 + 64 NuclAT_19 - -
- 1282154..1282217 + 64 NuclAT_19 - -
- 1282154..1282217 + 64 NuclAT_20 - -
- 1282154..1282217 + 64 NuclAT_20 - -
- 1282154..1282217 + 64 NuclAT_20 - -
- 1282154..1282217 + 64 NuclAT_20 - -
- 1282154..1282217 + 64 NuclAT_21 - -
- 1282154..1282217 + 64 NuclAT_21 - -
- 1282154..1282217 + 64 NuclAT_21 - -
- 1282154..1282217 + 64 NuclAT_21 - -
- 1282154..1282217 + 64 NuclAT_22 - -
- 1282154..1282217 + 64 NuclAT_22 - -
- 1282154..1282217 + 64 NuclAT_22 - -
- 1282154..1282217 + 64 NuclAT_22 - -
AKO63_RS06525 1282507..1283607 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
AKO63_RS06530 1283877..1284107 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AKO63_RS06535 1284253..1284948 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
AKO63_RS06540 1284992..1285345 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
AKO63_RS06545 1285530..1286924 + 1395 WP_001538647.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T56362 WP_000170954.1 NZ_CP012379:c1282101-1281994 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T56362 NZ_CP012379:c1282101-1281994 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT56362 NZ_CP012379:1282154-1282215 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References