Detailed information of TA system TA051347

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-istR/Ldr(toxin)
• Location: 4531048..4531269
• Replicon: chromosome
• Accession: NZ_CP010200
• Organism: Escherichia coli strain M10

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1PGT3
• Locus tag: RG59_RS23440
• Protein ID: WP_000170954.1
• Coordinates: 4531048..4531155 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	istR
Locus tag	-
Coordinates	4531203..4531269 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
RG59_RS23415	4526892..4527974	+	1083	WP_000804726.1	peptide chain release factor 1	-
RG59_RS23420	4527974..4528807	+	834	WP_000456572.1	peptide chain release factor N(5)-glutamine methyltransferase	-
RG59_RS23425	4528804..4529196	+	393	WP_000200378.1	invasion regulator SirB2	-
RG59_RS23430	4529200..4530009	+	810	WP_001257044.1	invasion regulator SirB1	-
RG59_RS23435	4530045..4530899	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
RG59_RS23440	4531048..4531155	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
RG59_RS23445	4531163..4531381	+	219	Protein_4278	integrase	-
-	4531203..4531269	+	67	NuclAT_15	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_15	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_15	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_15	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_16	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_16	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_16	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_16	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_17	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_17	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_17	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_17	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_18	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_18	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_18	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_18	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_19	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_19	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_19	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_19	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_20	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_20	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_20	-	Antitoxin
-	4531203..4531269	+	67	NuclAT_20	-	Antitoxin
-	4531205..4531268	+	64	NuclAT_39	-	-
-	4531205..4531268	+	64	NuclAT_39	-	-
-	4531205..4531268	+	64	NuclAT_39	-	-
-	4531205..4531268	+	64	NuclAT_39	-	-
-	4531205..4531268	+	64	NuclAT_40	-	-
-	4531205..4531268	+	64	NuclAT_40	-	-
-	4531205..4531268	+	64	NuclAT_40	-	-
-	4531205..4531268	+	64	NuclAT_40	-	-
RG59_RS23450	4531560..4532660	-	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
RG59_RS23455	4532930..4533160	+	231	WP_001146442.1	putative cation transport regulator ChaB	-
RG59_RS23460	4533318..4534013	+	696	WP_033561053.1	glutathione-specific gamma-glutamylcyclotransferase	-
RG59_RS23465	4534057..4534410	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
RG59_RS23470	4534595..4535989	+	1395	WP_000086213.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3983.80 Da
• Isoelectric Point: 11.4779

>T51347 WP_000170954.1 NZ_CP010200:c4531155-4531048 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T51347 NZ_CP010200:c4531155-4531048 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT51347 NZ_CP010200:4531203-4531269 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Structures

Toxin

• AlphaFold DB: A0A7U9LPE9

Antitoxin