Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 1958937..1959158 Replicon chromosome
Accession NZ_CP007394
Organism Escherichia coli strain ST2747

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag CF60_RS09405 Protein ID WP_000176713.1
Coordinates 1958937..1959044 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 1959092..1959158 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CF60_RS09380 1954782..1955864 + 1083 WP_025210407.1 peptide chain release factor 1 -
CF60_RS09385 1955864..1956697 + 834 WP_001578206.1 peptide chain release factor N(5)-glutamine methyltransferase -
CF60_RS09390 1956694..1957086 + 393 WP_000200377.1 invasion regulator SirB2 -
CF60_RS09395 1957090..1957899 + 810 WP_025210408.1 invasion regulator SirB1 -
CF60_RS09400 1957935..1958789 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CF60_RS09405 1958937..1959044 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1959092..1959158 + 67 NuclAT_13 - Antitoxin
- 1959092..1959158 + 67 NuclAT_13 - Antitoxin
- 1959092..1959158 + 67 NuclAT_13 - Antitoxin
- 1959092..1959158 + 67 NuclAT_13 - Antitoxin
- 1959092..1959158 + 67 NuclAT_15 - Antitoxin
- 1959092..1959158 + 67 NuclAT_15 - Antitoxin
- 1959092..1959158 + 67 NuclAT_15 - Antitoxin
- 1959092..1959158 + 67 NuclAT_15 - Antitoxin
- 1959092..1959158 + 67 NuclAT_17 - Antitoxin
- 1959092..1959158 + 67 NuclAT_17 - Antitoxin
- 1959092..1959158 + 67 NuclAT_17 - Antitoxin
- 1959092..1959158 + 67 NuclAT_17 - Antitoxin
- 1959092..1959158 + 67 NuclAT_19 - Antitoxin
- 1959092..1959158 + 67 NuclAT_19 - Antitoxin
- 1959092..1959158 + 67 NuclAT_19 - Antitoxin
- 1959092..1959158 + 67 NuclAT_19 - Antitoxin
- 1959092..1959158 + 67 NuclAT_21 - Antitoxin
- 1959092..1959158 + 67 NuclAT_21 - Antitoxin
- 1959092..1959158 + 67 NuclAT_21 - Antitoxin
- 1959092..1959158 + 67 NuclAT_21 - Antitoxin
- 1959092..1959158 + 67 NuclAT_23 - Antitoxin
- 1959092..1959158 + 67 NuclAT_23 - Antitoxin
- 1959092..1959158 + 67 NuclAT_23 - Antitoxin
- 1959092..1959158 + 67 NuclAT_23 - Antitoxin
- 1959094..1959157 + 64 NuclAT_38 - -
- 1959094..1959157 + 64 NuclAT_38 - -
- 1959094..1959157 + 64 NuclAT_38 - -
- 1959094..1959157 + 64 NuclAT_38 - -
- 1959094..1959157 + 64 NuclAT_40 - -
- 1959094..1959157 + 64 NuclAT_40 - -
- 1959094..1959157 + 64 NuclAT_40 - -
- 1959094..1959157 + 64 NuclAT_40 - -
CF60_RS09410 1959472..1959579 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1959632..1959693 + 62 NuclAT_37 - -
- 1959632..1959693 + 62 NuclAT_37 - -
- 1959632..1959693 + 62 NuclAT_37 - -
- 1959632..1959693 + 62 NuclAT_37 - -
- 1959632..1959693 + 62 NuclAT_39 - -
- 1959632..1959693 + 62 NuclAT_39 - -
- 1959632..1959693 + 62 NuclAT_39 - -
- 1959632..1959693 + 62 NuclAT_39 - -
- 1959632..1959694 + 63 NuclAT_14 - -
- 1959632..1959694 + 63 NuclAT_14 - -
- 1959632..1959694 + 63 NuclAT_14 - -
- 1959632..1959694 + 63 NuclAT_14 - -
- 1959632..1959694 + 63 NuclAT_16 - -
- 1959632..1959694 + 63 NuclAT_16 - -
- 1959632..1959694 + 63 NuclAT_16 - -
- 1959632..1959694 + 63 NuclAT_16 - -
- 1959632..1959694 + 63 NuclAT_18 - -
- 1959632..1959694 + 63 NuclAT_18 - -
- 1959632..1959694 + 63 NuclAT_18 - -
- 1959632..1959694 + 63 NuclAT_18 - -
- 1959632..1959694 + 63 NuclAT_20 - -
- 1959632..1959694 + 63 NuclAT_20 - -
- 1959632..1959694 + 63 NuclAT_20 - -
- 1959632..1959694 + 63 NuclAT_20 - -
- 1959632..1959694 + 63 NuclAT_22 - -
- 1959632..1959694 + 63 NuclAT_22 - -
- 1959632..1959694 + 63 NuclAT_22 - -
- 1959632..1959694 + 63 NuclAT_22 - -
- 1959632..1959694 + 63 NuclAT_24 - -
- 1959632..1959694 + 63 NuclAT_24 - -
- 1959632..1959694 + 63 NuclAT_24 - -
- 1959632..1959694 + 63 NuclAT_24 - -
CF60_RS09415 1959985..1961085 - 1101 WP_001366250.1 sodium-potassium/proton antiporter ChaA -
CF60_RS09420 1961355..1961585 + 231 WP_001578208.1 putative cation transport regulator ChaB -
CF60_RS09425 1961743..1962438 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
CF60_RS09430 1962482..1962835 - 354 WP_001578209.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T46382 WP_000176713.1 NZ_CP007394:c1959044-1958937 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T46382 NZ_CP007394:c1959044-1958937 [Escherichia coli]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT46382 NZ_CP007394:1959092-1959158 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8


Antitoxin

Download structure file

References