Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1197563..1197788 | Replicon | chromosome |
| Accession | NZ_CP007275 | ||
| Organism | Escherichia coli strain O18 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | NMECO18_RS06465 | Protein ID | WP_000813254.1 |
| Coordinates | 1197563..1197718 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1197730..1197788 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NMECO18_RS06410 | 1192643..1192957 | - | 315 | WP_000193273.1 | YdfR family protein | - |
| NMECO18_RS06415 | 1192962..1193177 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| NMECO18_RS06440 | 1193902..1194615 | - | 714 | WP_000342820.1 | hypothetical protein | - |
| NMECO18_RS06445 | 1194861..1195682 | - | 822 | WP_001235237.1 | antitermination protein | - |
| NMECO18_RS06450 | 1195679..1196053 | - | 375 | WP_001217427.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NMECO18_RS06455 | 1196066..1197115 | - | 1050 | WP_001265292.1 | DUF968 domain-containing protein | - |
| NMECO18_RS25445 | 1197117..1197395 | - | 279 | WP_024193993.1 | hypothetical protein | - |
| NMECO18_RS06465 | 1197563..1197718 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 1197730..1197788 | + | 59 | - | - | Antitoxin |
| NMECO18_RS06470 | 1197956..1198621 | - | 666 | WP_000150294.1 | epoxyqueuosine reductase QueH | - |
| NMECO18_RS06475 | 1198796..1199221 | - | 426 | WP_001151152.1 | DUF977 family protein | - |
| NMECO18_RS06480 | 1199262..1200332 | - | 1071 | WP_001262357.1 | hypothetical protein | - |
| NMECO18_RS06485 | 1200404..1200829 | - | 426 | WP_000693918.1 | Rha family transcriptional regulator | - |
| NMECO18_RS06490 | 1200813..1201085 | - | 273 | WP_000887447.1 | helix-turn-helix domain-containing protein | - |
| NMECO18_RS06495 | 1201195..1201596 | + | 402 | WP_001329851.1 | helix-turn-helix domain-containing protein | - |
| NMECO18_RS06500 | 1201624..1201815 | + | 192 | WP_000100899.1 | hypothetical protein | - |
| NMECO18_RS06505 | 1201815..1202102 | + | 288 | WP_000936799.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| NMECO18_RS06510 | 1202373..1202525 | + | 153 | WP_000379609.1 | DUF1391 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ybtS / ybtX / ybtQ / ybtP | 1170476..1217739 | 47263 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T46256 WP_000813254.1 NZ_CP007275:c1197718-1197563 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T46256 NZ_CP007275:c1197718-1197563 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT46256 NZ_CP007275:1197730-1197788 [Escherichia coli]
CCTTGCCTTTCGGCATGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCATGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|