Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1493802..1494071 | Replicon | chromosome |
| Accession | NZ_CP007265 | ||
| Organism | Escherichia coli strain ST540 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | BU34_RS07575 | Protein ID | WP_001312861.1 |
| Coordinates | 1493913..1494071 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 1493802..1493867 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BU34_RS27355 | 1489337..1489543 | + | 207 | WP_000275853.1 | hypothetical protein | - |
| BU34_RS07545 | 1489569..1490108 | + | 540 | WP_000290839.1 | single-stranded DNA-binding protein | - |
| BU34_RS07550 | 1490171..1490404 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| BU34_RS07555 | 1490470..1492428 | + | 1959 | WP_025269850.1 | ParB/RepB/Spo0J family partition protein | - |
| BU34_RS07560 | 1492483..1492917 | + | 435 | WP_001470779.1 | conjugation system SOS inhibitor PsiB | - |
| BU34_RS07565 | 1492914..1493633 | + | 720 | WP_001276232.1 | plasmid SOS inhibition protein A | - |
| BU34_RS27190 | 1493645..1493833 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 1493645..1493869 | + | 225 | NuclAT_0 | - | - |
| - | 1493645..1493869 | + | 225 | NuclAT_0 | - | - |
| - | 1493645..1493869 | + | 225 | NuclAT_0 | - | - |
| - | 1493645..1493869 | + | 225 | NuclAT_0 | - | - |
| - | 1493802..1493867 | + | 66 | - | - | Antitoxin |
| BU34_RS07575 | 1493913..1494071 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| BU34_RS27360 | 1494762..1494968 | + | 207 | WP_000547974.1 | hypothetical protein | - |
| BU34_RS07590 | 1494993..1495280 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| BU34_RS07595 | 1495399..1496220 | + | 822 | WP_025269852.1 | DUF945 domain-containing protein | - |
| BU34_RS07600 | 1496517..1497026 | - | 510 | WP_025269853.1 | transglycosylase SLT domain-containing protein | - |
| BU34_RS07605 | 1497441..1497824 | + | 384 | WP_025269854.1 | relaxosome protein TraM | - |
| BU34_RS07610 | 1498015..1498701 | + | 687 | WP_025269855.1 | PAS domain-containing protein | - |
| BU34_RS07615 | 1498795..1499022 | + | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1460269..1497026 | 36757 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T46221 WP_001312861.1 NZ_CP007265:1493913-1494071 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T46221 NZ_CP007265:1493913-1494071 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT46221 NZ_CP007265:1493802-1493867 [Escherichia coli]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|