Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 1342374..1342595 Replicon chromosome
Accession NZ_CP006632
Organism Escherichia coli PCN033

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag PPECC33_RS06470 Protein ID WP_000176713.1
Coordinates 1342374..1342481 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 1342529..1342595 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PPECC33_RS06445 1338219..1339301 + 1083 WP_000804726.1 peptide chain release factor 1 -
PPECC33_RS06450 1339301..1340134 + 834 WP_000456478.1 peptide chain release factor N(5)-glutamine methyltransferase -
PPECC33_RS06455 1340131..1340523 + 393 WP_000200378.1 invasion regulator SirB2 -
PPECC33_RS06460 1340527..1341336 + 810 WP_001257044.1 invasion regulator SirB1 -
PPECC33_RS06465 1341372..1342226 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
PPECC33_RS06470 1342374..1342481 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1342529..1342595 + 67 NuclAT_11 - Antitoxin
- 1342529..1342595 + 67 NuclAT_11 - Antitoxin
- 1342529..1342595 + 67 NuclAT_11 - Antitoxin
- 1342529..1342595 + 67 NuclAT_11 - Antitoxin
- 1342529..1342595 + 67 NuclAT_13 - Antitoxin
- 1342529..1342595 + 67 NuclAT_13 - Antitoxin
- 1342529..1342595 + 67 NuclAT_13 - Antitoxin
- 1342529..1342595 + 67 NuclAT_13 - Antitoxin
- 1342529..1342595 + 67 NuclAT_15 - Antitoxin
- 1342529..1342595 + 67 NuclAT_15 - Antitoxin
- 1342529..1342595 + 67 NuclAT_15 - Antitoxin
- 1342529..1342595 + 67 NuclAT_15 - Antitoxin
- 1342529..1342595 + 67 NuclAT_17 - Antitoxin
- 1342529..1342595 + 67 NuclAT_17 - Antitoxin
- 1342529..1342595 + 67 NuclAT_17 - Antitoxin
- 1342529..1342595 + 67 NuclAT_17 - Antitoxin
- 1342529..1342595 + 67 NuclAT_19 - Antitoxin
- 1342529..1342595 + 67 NuclAT_19 - Antitoxin
- 1342529..1342595 + 67 NuclAT_19 - Antitoxin
- 1342529..1342595 + 67 NuclAT_19 - Antitoxin
- 1342529..1342595 + 67 NuclAT_9 - Antitoxin
- 1342529..1342595 + 67 NuclAT_9 - Antitoxin
- 1342529..1342595 + 67 NuclAT_9 - Antitoxin
- 1342529..1342595 + 67 NuclAT_9 - Antitoxin
- 1342531..1342594 + 64 NuclAT_22 - -
- 1342531..1342594 + 64 NuclAT_22 - -
- 1342531..1342594 + 64 NuclAT_22 - -
- 1342531..1342594 + 64 NuclAT_22 - -
- 1342531..1342594 + 64 NuclAT_24 - -
- 1342531..1342594 + 64 NuclAT_24 - -
- 1342531..1342594 + 64 NuclAT_24 - -
- 1342531..1342594 + 64 NuclAT_24 - -
- 1342531..1342594 + 64 NuclAT_26 - -
- 1342531..1342594 + 64 NuclAT_26 - -
- 1342531..1342594 + 64 NuclAT_26 - -
- 1342531..1342594 + 64 NuclAT_26 - -
- 1342531..1342594 + 64 NuclAT_28 - -
- 1342531..1342594 + 64 NuclAT_28 - -
- 1342531..1342594 + 64 NuclAT_28 - -
- 1342531..1342594 + 64 NuclAT_28 - -
- 1342531..1342594 + 64 NuclAT_30 - -
- 1342531..1342594 + 64 NuclAT_30 - -
- 1342531..1342594 + 64 NuclAT_30 - -
- 1342531..1342594 + 64 NuclAT_30 - -
- 1342531..1342594 + 64 NuclAT_32 - -
- 1342531..1342594 + 64 NuclAT_32 - -
- 1342531..1342594 + 64 NuclAT_32 - -
- 1342531..1342594 + 64 NuclAT_32 - -
- 1342531..1342596 + 66 NuclAT_34 - -
- 1342531..1342596 + 66 NuclAT_34 - -
- 1342531..1342596 + 66 NuclAT_34 - -
- 1342531..1342596 + 66 NuclAT_34 - -
- 1342531..1342596 + 66 NuclAT_36 - -
- 1342531..1342596 + 66 NuclAT_36 - -
- 1342531..1342596 + 66 NuclAT_36 - -
- 1342531..1342596 + 66 NuclAT_36 - -
- 1342531..1342596 + 66 NuclAT_38 - -
- 1342531..1342596 + 66 NuclAT_38 - -
- 1342531..1342596 + 66 NuclAT_38 - -
- 1342531..1342596 + 66 NuclAT_38 - -
- 1342531..1342596 + 66 NuclAT_40 - -
- 1342531..1342596 + 66 NuclAT_40 - -
- 1342531..1342596 + 66 NuclAT_40 - -
- 1342531..1342596 + 66 NuclAT_40 - -
PPECC33_RS06475 1342909..1343016 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1343069..1343130 + 62 NuclAT_21 - -
- 1343069..1343130 + 62 NuclAT_21 - -
- 1343069..1343130 + 62 NuclAT_21 - -
- 1343069..1343130 + 62 NuclAT_21 - -
- 1343069..1343130 + 62 NuclAT_23 - -
- 1343069..1343130 + 62 NuclAT_23 - -
- 1343069..1343130 + 62 NuclAT_23 - -
- 1343069..1343130 + 62 NuclAT_23 - -
- 1343069..1343130 + 62 NuclAT_25 - -
- 1343069..1343130 + 62 NuclAT_25 - -
- 1343069..1343130 + 62 NuclAT_25 - -
- 1343069..1343130 + 62 NuclAT_25 - -
- 1343069..1343130 + 62 NuclAT_27 - -
- 1343069..1343130 + 62 NuclAT_27 - -
- 1343069..1343130 + 62 NuclAT_27 - -
- 1343069..1343130 + 62 NuclAT_27 - -
- 1343069..1343130 + 62 NuclAT_29 - -
- 1343069..1343130 + 62 NuclAT_29 - -
- 1343069..1343130 + 62 NuclAT_29 - -
- 1343069..1343130 + 62 NuclAT_29 - -
- 1343069..1343130 + 62 NuclAT_31 - -
- 1343069..1343130 + 62 NuclAT_31 - -
- 1343069..1343130 + 62 NuclAT_31 - -
- 1343069..1343130 + 62 NuclAT_31 - -
- 1343069..1343131 + 63 NuclAT_10 - -
- 1343069..1343131 + 63 NuclAT_10 - -
- 1343069..1343131 + 63 NuclAT_10 - -
- 1343069..1343131 + 63 NuclAT_10 - -
- 1343069..1343131 + 63 NuclAT_12 - -
- 1343069..1343131 + 63 NuclAT_12 - -
- 1343069..1343131 + 63 NuclAT_12 - -
- 1343069..1343131 + 63 NuclAT_12 - -
- 1343069..1343131 + 63 NuclAT_14 - -
- 1343069..1343131 + 63 NuclAT_14 - -
- 1343069..1343131 + 63 NuclAT_14 - -
- 1343069..1343131 + 63 NuclAT_14 - -
- 1343069..1343131 + 63 NuclAT_16 - -
- 1343069..1343131 + 63 NuclAT_16 - -
- 1343069..1343131 + 63 NuclAT_16 - -
- 1343069..1343131 + 63 NuclAT_16 - -
- 1343069..1343131 + 63 NuclAT_18 - -
- 1343069..1343131 + 63 NuclAT_18 - -
- 1343069..1343131 + 63 NuclAT_18 - -
- 1343069..1343131 + 63 NuclAT_18 - -
- 1343069..1343131 + 63 NuclAT_20 - -
- 1343069..1343131 + 63 NuclAT_20 - -
- 1343069..1343131 + 63 NuclAT_20 - -
- 1343069..1343131 + 63 NuclAT_20 - -
- 1343069..1343132 + 64 NuclAT_33 - -
- 1343069..1343132 + 64 NuclAT_33 - -
- 1343069..1343132 + 64 NuclAT_33 - -
- 1343069..1343132 + 64 NuclAT_33 - -
- 1343069..1343132 + 64 NuclAT_35 - -
- 1343069..1343132 + 64 NuclAT_35 - -
- 1343069..1343132 + 64 NuclAT_35 - -
- 1343069..1343132 + 64 NuclAT_35 - -
- 1343069..1343132 + 64 NuclAT_37 - -
- 1343069..1343132 + 64 NuclAT_37 - -
- 1343069..1343132 + 64 NuclAT_37 - -
- 1343069..1343132 + 64 NuclAT_37 - -
- 1343069..1343132 + 64 NuclAT_39 - -
- 1343069..1343132 + 64 NuclAT_39 - -
- 1343069..1343132 + 64 NuclAT_39 - -
- 1343069..1343132 + 64 NuclAT_39 - -
PPECC33_RS06480 1343422..1344522 - 1101 WP_001366250.1 sodium-potassium/proton antiporter ChaA -
PPECC33_RS06485 1344792..1345022 + 231 WP_001146444.1 putative cation transport regulator ChaB -
PPECC33_RS06490 1345180..1345875 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
PPECC33_RS06495 1345919..1346272 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T45298 WP_000176713.1 NZ_CP006632:c1342481-1342374 [Escherichia coli PCN033]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T45298 NZ_CP006632:c1342481-1342374 [Escherichia coli PCN033]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT45298 NZ_CP006632:1342529-1342595 [Escherichia coli PCN033]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References