Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2103319..2103544 | Replicon | chromosome |
| Accession | NZ_CP004057 | ||
| Organism | Shigella flexneri Shi06HN006 isolate Human | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | SFYV_RS11845 | Protein ID | WP_000813254.1 |
| Coordinates | 2103319..2103474 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2103486..2103544 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SFYV_RS11790 | 2098631..2098981 | - | 351 | WP_005048975.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| SFYV_RS11795 | 2098978..2099652 | - | 675 | WP_004967157.1 | IS66-like element accessory protein TnpA | - |
| SFYV_RS11800 | 2099751..2099966 | - | 216 | WP_000839572.1 | class II holin family protein | - |
| SFYV_RS11825 | 2100762..2101450 | - | 689 | Protein_2136 | bacteriophage antitermination protein Q | - |
| SFYV_RS11830 | 2101447..2101812 | - | 366 | WP_000140020.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SFYV_RS11835 | 2101813..2102871 | - | 1059 | WP_001265248.1 | DUF968 domain-containing protein | - |
| SFYV_RS26665 | 2102873..2103151 | - | 279 | WP_011069426.1 | hypothetical protein | - |
| SFYV_RS11845 | 2103319..2103474 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2103486..2103544 | + | 59 | - | - | Antitoxin |
| SFYV_RS11855 | 2104126..2104542 | - | 417 | WP_005069274.1 | hypothetical protein | - |
| SFYV_RS11860 | 2104569..2104709 | + | 141 | Protein_2142 | DUF4224 domain-containing protein | - |
| SFYV_RS11865 | 2104709..2105759 | + | 1051 | Protein_2143 | tyrosine-type recombinase/integrase | - |
| SFYV_RS11875 | 2105970..2106767 | + | 798 | WP_001325918.1 | DgsA anti-repressor MtfA | - |
| SFYV_RS11885 | 2107105..2108367 | + | 1263 | Protein_2145 | tyrosine-type recombinase/integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | ipaH9.8 | 2070133..2131958 | 61825 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T44949 WP_000813254.1 NZ_CP004057:c2103474-2103319 [Shigella flexneri Shi06HN006]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T44949 NZ_CP004057:c2103474-2103319 [Shigella flexneri Shi06HN006]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTTATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT44949 NZ_CP004057:2103486-2103544 [Shigella flexneri Shi06HN006]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|